BLASTX nr result
ID: Mentha29_contig00030293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00030293 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004248587.1| PREDICTED: uncharacterized protein LOC101255... 57 3e-06 emb|CAN75301.1| hypothetical protein VITISV_008678 [Vitis vinifera] 46 6e-06 >ref|XP_004248587.1| PREDICTED: uncharacterized protein LOC101255439 [Solanum lycopersicum] Length = 318 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 64 DGNWYVDSGATTHITHDFSNLAISSDYSGNENLIVGNG 177 D +W +DSGAT H+T D NL+I+SDYSGN++L VGNG Sbjct: 256 DPSWCLDSGATNHVTADVGNLSIASDYSGNDSLAVGNG 293 >emb|CAN75301.1| hypothetical protein VITISV_008678 [Vitis vinifera] Length = 248 Score = 45.8 bits (107), Expect(2) = 6e-06 Identities = 18/41 (43%), Positives = 26/41 (63%) Frame = +1 Query: 64 DGNWYVDSGATTHITHDFSNLAISSDYSGNENLIVGNGQNQ 186 D +WY DSGAT H+ + NL + S+Y G + L+V N N+ Sbjct: 144 DQSWYDDSGATNHVIAELGNLLMKSNYHGEDKLVVDNADNK 184 Score = 29.6 bits (65), Expect(2) = 6e-06 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 167 LEMDKINHKTLLKGNLSKGLYQLDL 241 L DK NH+ LL+G L GLY+L + Sbjct: 195 LVKDKENHQVLLQGKLEDGLYKLHI 219