BLASTX nr result
ID: Mentha29_contig00029967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00029967 (214 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007011878.1| DEAD/DEAH box RNA helicase family protein is... 70 3e-10 emb|CAN76234.1| hypothetical protein VITISV_030204 [Vitis vinifera] 69 9e-10 ref|XP_003728713.1| PREDICTED: spliceosome RNA helicase DDX39B-l... 68 1e-09 ref|XP_003604423.1| ATP-dependent RNA helicase SUB2-2 [Medicago ... 67 3e-09 gb|EXB67307.1| DEAD-box ATP-dependent RNA helicase 56 [Morus not... 65 4e-09 ref|XP_002517621.1| hypothetical protein RCOM_0899280 [Ricinus c... 66 4e-09 gb|EXB88204.1| DEAD-box ATP-dependent RNA helicase 56 [Morus not... 65 7e-09 gb|EEC70859.1| hypothetical protein OsI_02371 [Oryza sativa Indi... 64 3e-08 gb|EMS68248.1| DEAD-box ATP-dependent RNA helicase 56 [Triticum ... 62 3e-08 ref|XP_004498730.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 62 3e-08 ref|NP_001154706.1| DEAD-box ATP-dependent RNA helicase 56 [Arab... 62 3e-08 ref|NP_001154707.1| DEAD-box ATP-dependent RNA helicase 56 [Arab... 62 3e-08 ref|XP_004501318.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 62 3e-08 dbj|BAJ53224.1| JHL06P13.3 [Jatropha curcas] 62 3e-08 ref|XP_004501319.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 62 3e-08 emb|CAA09205.1| RNA helicase [Arabidopsis thaliana] 62 3e-08 ref|XP_004291460.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 62 3e-08 ref|XP_006585632.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 62 3e-08 ref|XP_004506912.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 62 3e-08 emb|CAB96652.1| DEAD BOX RNA helicase RH15-like protein [Arabido... 62 3e-08 >ref|XP_007011878.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma cacao] gi|508782241|gb|EOY29497.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma cacao] Length = 485 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGKSLTSL 105 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGK LT L Sbjct: 44 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGKFLTLL 79 >emb|CAN76234.1| hypothetical protein VITISV_030204 [Vitis vinifera] Length = 383 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGKSLTSLYLG 96 IHSSGFRDFLLKPELLR+IVDSGFEHPSEGK + LG Sbjct: 44 IHSSGFRDFLLKPELLRSIVDSGFEHPSEGKCIPQAILG 82 >ref|XP_003728713.1| PREDICTED: spliceosome RNA helicase DDX39B-like [Strongylocentrotus purpuratus] Length = 80 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGKSLT 111 IHSSGFRDFLLKPELLRAIVD GFEHPSEGKSL+ Sbjct: 44 IHSSGFRDFLLKPELLRAIVDCGFEHPSEGKSLS 77 >ref|XP_003604423.1| ATP-dependent RNA helicase SUB2-2 [Medicago truncatula] gi|355505478|gb|AES86620.1| ATP-dependent RNA helicase SUB2-2 [Medicago truncatula] Length = 63 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGK 120 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGK Sbjct: 22 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGK 52 >gb|EXB67307.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis] Length = 525 Score = 65.5 bits (158), Expect(2) = 4e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGKSLTSL 105 IHSSGFRDFLLKPELLRAIVDSGFEHPSEG + ++ Sbjct: 47 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGNVINTV 82 Score = 20.8 bits (42), Expect(2) = 4e-09 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 21 VQHECIP 1 VQHECIP Sbjct: 107 VQHECIP 113 >ref|XP_002517621.1| hypothetical protein RCOM_0899280 [Ricinus communis] gi|223543253|gb|EEF44785.1| hypothetical protein RCOM_0899280 [Ricinus communis] Length = 149 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGK 120 IHSSGFRDFLLKPELLRAI+DSGFEHPSEGK Sbjct: 48 IHSSGFRDFLLKPELLRAIIDSGFEHPSEGK 78 >gb|EXB88204.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis] Length = 518 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/38 (84%), Positives = 32/38 (84%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGKSLTSLYL 99 IHSSGFRDFLLKPELLRAIVDSGFEHPSEG S L Sbjct: 44 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGNLSNSFSL 81 >gb|EEC70859.1| hypothetical protein OsI_02371 [Oryza sativa Indica Group] Length = 102 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGKSLTS 108 IHSSGFRDFLLKPELLRAI D GFEHPSEGK + S Sbjct: 48 IHSSGFRDFLLKPELLRAIQDCGFEHPSEGKLICS 82 >gb|EMS68248.1| DEAD-box ATP-dependent RNA helicase 56 [Triticum urartu] Length = 657 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSEGK 120 IHSSGFRDFLLKPELLRAI D GFEHPSEGK Sbjct: 49 IHSSGFRDFLLKPELLRAIQDCGFEHPSEGK 79 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 21 VQHECIP 1 VQHECIP Sbjct: 109 VQHECIP 115 >ref|XP_004498730.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X1 [Cicer arietinum] Length = 487 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 126 IHSSGFRDFLLKPELLRAIVDSGFEHPSE Sbjct: 43 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 71 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 21 VQHECIP 1 VQHECIP Sbjct: 72 VQHECIP 78 >ref|NP_001154706.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana] gi|332004263|gb|AED91646.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana] Length = 486 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 126 IHSSGFRDFLLKPELLRAIVDSGFEHPSE Sbjct: 43 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 71 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 21 VQHECIP 1 VQHECIP Sbjct: 72 VQHECIP 78 >ref|NP_001154707.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana] gi|332004264|gb|AED91647.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana] Length = 468 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 126 IHSSGFRDFLLKPELLRAIVDSGFEHPSE Sbjct: 43 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 71 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 21 VQHECIP 1 VQHECIP Sbjct: 72 VQHECIP 78 >ref|XP_004501318.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X1 [Cicer arietinum] Length = 455 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 126 IHSSGFRDFLLKPELLRAIVDSGFEHPSE Sbjct: 43 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 71 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 21 VQHECIP 1 VQHECIP Sbjct: 72 VQHECIP 78 >dbj|BAJ53224.1| JHL06P13.3 [Jatropha curcas] Length = 455 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 126 IHSSGFRDFLLKPELLRAIVDSGFEHPSE Sbjct: 44 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 72 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 21 VQHECIP 1 VQHECIP Sbjct: 73 VQHECIP 79 >ref|XP_004501319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Cicer arietinum] Length = 451 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 126 IHSSGFRDFLLKPELLRAIVDSGFEHPSE Sbjct: 43 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 71 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 21 VQHECIP 1 VQHECIP Sbjct: 72 VQHECIP 78 >emb|CAA09205.1| RNA helicase [Arabidopsis thaliana] Length = 451 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 126 IHSSGFRDFLLKPELLRAIVDSGFEHPSE Sbjct: 67 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 95 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 21 VQHECIP 1 VQHECIP Sbjct: 96 VQHECIP 102 >ref|XP_004291460.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Fragaria vesca subsp. vesca] Length = 447 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 126 IHSSGFRDFLLKPELLRAIVDSGFEHPSE Sbjct: 42 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 70 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 21 VQHECIP 1 VQHECIP Sbjct: 71 VQHECIP 77 >ref|XP_006585632.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 [Glycine max] Length = 440 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 126 IHSSGFRDFLLKPELLRAIVDSGFEHPSE Sbjct: 42 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 70 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 21 VQHECIP 1 VQHECIP Sbjct: 71 VQHECIP 77 >ref|XP_004506912.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X1 [Cicer arietinum] Length = 435 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 126 IHSSGFRDFLLKPELLRAIVDSGFEHPSE Sbjct: 42 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 70 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 21 VQHECIP 1 VQHECIP Sbjct: 71 VQHECIP 77 >emb|CAB96652.1| DEAD BOX RNA helicase RH15-like protein [Arabidopsis thaliana] Length = 435 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 212 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 126 IHSSGFRDFLLKPELLRAIVDSGFEHPSE Sbjct: 43 IHSSGFRDFLLKPELLRAIVDSGFEHPSE 71 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 21 VQHECIP 1 VQHECIP Sbjct: 72 VQHECIP 78