BLASTX nr result
ID: Mentha29_contig00029913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00029913 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30618.1| hypothetical protein MIMGU_mgv11b024201mg, partia... 96 4e-18 gb|EPS60920.1| hypothetical protein M569_13881 [Genlisea aurea] 92 8e-17 ref|XP_003538595.2| PREDICTED: DNA ligase 1-like isoform X1 [Gly... 78 1e-12 ref|XP_006591485.1| PREDICTED: DNA ligase 1-like isoform X2 [Gly... 78 1e-12 ref|XP_004239144.1| PREDICTED: uncharacterized protein LOC101246... 77 2e-12 ref|XP_006357585.1| PREDICTED: DNA ligase 1-like [Solanum tubero... 77 3e-12 ref|XP_007222392.1| hypothetical protein PRUPE_ppa004889mg [Prun... 76 4e-12 ref|XP_003551986.1| PREDICTED: uncharacterized protein LOC100806... 76 4e-12 gb|EXB82497.1| hypothetical protein L484_027672 [Morus notabilis] 74 2e-11 ref|XP_007163688.1| hypothetical protein PHAVU_001G255700g [Phas... 73 5e-11 ref|XP_004310155.1| PREDICTED: uncharacterized protein LOC101307... 71 1e-10 ref|XP_002530050.1| conserved hypothetical protein [Ricinus comm... 71 1e-10 ref|XP_006483968.1| PREDICTED: coilin-like isoform X2 [Citrus si... 70 2e-10 ref|XP_006483967.1| PREDICTED: coilin-like isoform X1 [Citrus si... 70 2e-10 ref|XP_006438225.1| hypothetical protein CICLE_v10030867mg [Citr... 70 2e-10 ref|XP_006438224.1| hypothetical protein CICLE_v10030867mg [Citr... 70 2e-10 ref|XP_002282307.2| PREDICTED: uncharacterized protein LOC100256... 70 2e-10 emb|CBI16805.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|XP_007044844.1| Sphere organelles protein-related, putative ... 70 4e-10 ref|XP_007044843.1| Sphere organelles protein-related, putative ... 70 4e-10 >gb|EYU30618.1| hypothetical protein MIMGU_mgv11b024201mg, partial [Mimulus guttatus] Length = 231 Score = 96.3 bits (238), Expect = 4e-18 Identities = 44/61 (72%), Positives = 56/61 (91%) Frame = +3 Query: 114 KRIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLL 293 KRIR+VF++DDIL+E+QK +GL+R WVLL+P+Q+D VSDVAS+LL +FQL QSCPHGLLL Sbjct: 7 KRIRLVFRDDDILTETQKSDGLNRSWVLLKPYQNDTVSDVASHLLHAFQLHQSCPHGLLL 66 Query: 294 S 296 S Sbjct: 67 S 67 >gb|EPS60920.1| hypothetical protein M569_13881 [Genlisea aurea] Length = 247 Score = 92.0 bits (227), Expect = 8e-17 Identities = 43/65 (66%), Positives = 51/65 (78%) Frame = +3 Query: 102 MELGKRIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPH 281 ME KRIRV+FK+ DILSE+ KLEGL R W+L +P +H VSDV S+LLRSFQL SCP Sbjct: 1 MEKAKRIRVIFKDKDILSEADKLEGLKRSWILFKPQEHGTVSDVVSHLLRSFQLHDSCPD 60 Query: 282 GLLLS 296 GL+LS Sbjct: 61 GLVLS 65 >ref|XP_003538595.2| PREDICTED: DNA ligase 1-like isoform X1 [Glycine max] Length = 633 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/60 (58%), Positives = 51/60 (85%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+RVVF++ +LS+S+K +GL RCW LL+P QH A+SDVAS+LL +F+L ++CPHG++LS Sbjct: 6 RLRVVFEDRGMLSKSKKKQGLKRCWFLLKP-QHTAISDVASHLLNTFRLHRTCPHGIVLS 64 >ref|XP_006591485.1| PREDICTED: DNA ligase 1-like isoform X2 [Glycine max] Length = 637 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/60 (58%), Positives = 51/60 (85%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+RVVF++ +LS+S+K +GL RCW LL+P QH A+SDVAS+LL +F+L ++CPHG++LS Sbjct: 6 RLRVVFEDRGMLSKSKKKQGLKRCWFLLKP-QHTAISDVASHLLNTFRLHRTCPHGIVLS 64 >ref|XP_004239144.1| PREDICTED: uncharacterized protein LOC101246716 [Solanum lycopersicum] Length = 813 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/62 (56%), Positives = 47/62 (75%) Frame = +3 Query: 111 GKRIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLL 290 G R+R+ F + DILS+ QK EG + W+LL+P QH VSD++SYLL +FQL SCP+G+L Sbjct: 3 GVRLRLSFNDPDILSDLQKSEGFVKTWLLLKPQQHRTVSDLSSYLLHTFQLHDSCPNGIL 62 Query: 291 LS 296 LS Sbjct: 63 LS 64 >ref|XP_006357585.1| PREDICTED: DNA ligase 1-like [Solanum tuberosum] Length = 826 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/62 (56%), Positives = 46/62 (74%) Frame = +3 Query: 111 GKRIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLL 290 G R+R+ F + DILS QK EG + W+LL+P QH VSD++SYLL +FQL SCP+G+L Sbjct: 3 GVRLRLSFNDPDILSNLQKSEGFVKTWLLLKPQQHRTVSDLSSYLLHTFQLHDSCPNGIL 62 Query: 291 LS 296 LS Sbjct: 63 LS 64 >ref|XP_007222392.1| hypothetical protein PRUPE_ppa004889mg [Prunus persica] gi|462419328|gb|EMJ23591.1| hypothetical protein PRUPE_ppa004889mg [Prunus persica] Length = 487 Score = 76.3 bits (186), Expect = 4e-12 Identities = 38/60 (63%), Positives = 46/60 (76%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+RV FKE ILS+SQK EGL R WVLL+PH H VSD+A++LL +F L SCP GLL+S Sbjct: 5 RLRVTFKERHILSKSQKTEGLKRSWVLLKPH-HRTVSDLAAHLLHAFDLNASCPDGLLIS 63 >ref|XP_003551986.1| PREDICTED: uncharacterized protein LOC100806980 [Glycine max] Length = 120 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/60 (56%), Positives = 50/60 (83%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+RVVF++ +LS+S+K +GL RCW LL+P QH +SDVAS+LL +F+L ++CPHG++LS Sbjct: 6 RLRVVFEDRGMLSKSKKKQGLKRCWFLLKP-QHTTISDVASHLLNTFRLHRTCPHGIVLS 64 >gb|EXB82497.1| hypothetical protein L484_027672 [Morus notabilis] Length = 658 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/65 (50%), Positives = 52/65 (80%) Frame = +3 Query: 102 MELGKRIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPH 281 ME+G R+R+VF++ +L++SQ++EGL R WVLL+PH H+ +S+VA +LLR F ++ +C Sbjct: 1 MEVGLRLRLVFEDCKMLTKSQRMEGLKRSWVLLKPH-HETISEVADHLLRVFDIDDACSD 59 Query: 282 GLLLS 296 GL+LS Sbjct: 60 GLVLS 64 >ref|XP_007163688.1| hypothetical protein PHAVU_001G255700g [Phaseolus vulgaris] gi|561037152|gb|ESW35682.1| hypothetical protein PHAVU_001G255700g [Phaseolus vulgaris] Length = 691 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/60 (55%), Positives = 49/60 (81%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+RVVF++ +LS+S+K EGL+RCW LL+P QH +SDVAS+L +F+L ++CP G++LS Sbjct: 6 RLRVVFEDRGMLSKSKKKEGLNRCWFLLKP-QHSTISDVASHLHNAFRLHRTCPRGIILS 64 >ref|XP_004310155.1| PREDICTED: uncharacterized protein LOC101307957 [Fragaria vesca subsp. vesca] Length = 683 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/60 (56%), Positives = 45/60 (75%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+RV FK+ ILS+SQ+ +GL R W+LL+P QH +SD+A+YLL F L SCP GLL+S Sbjct: 8 RVRVEFKDRHILSKSQRTDGLRRSWILLKP-QHRTISDLAAYLLHVFNLHHSCPDGLLIS 66 >ref|XP_002530050.1| conserved hypothetical protein [Ricinus communis] gi|223530466|gb|EEF32350.1| conserved hypothetical protein [Ricinus communis] Length = 607 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/59 (57%), Positives = 44/59 (74%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLL 293 R+R+VF D ILS+ Q +GL RCW+LL+P QH +SD++SYLL F L+ CPHGLLL Sbjct: 5 RLRLVF--DQILSKVQNTQGLKRCWILLKP-QHQTISDLSSYLLNVFNLQNHCPHGLLL 60 >ref|XP_006483968.1| PREDICTED: coilin-like isoform X2 [Citrus sinensis] Length = 689 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/60 (55%), Positives = 42/60 (70%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+RVVF+ ILSE+QK EGL + W+L +P +SD+A YLLR F L S PHGL+LS Sbjct: 6 RVRVVFEGQHILSEAQKKEGLKKSWILFKPKHLKTISDLADYLLRIFHLHHSSPHGLVLS 65 >ref|XP_006483967.1| PREDICTED: coilin-like isoform X1 [Citrus sinensis] Length = 691 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/60 (55%), Positives = 42/60 (70%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+RVVF+ ILSE+QK EGL + W+L +P +SD+A YLLR F L S PHGL+LS Sbjct: 6 RVRVVFEGQHILSEAQKKEGLKKSWILFKPKHLKTISDLADYLLRIFHLHHSSPHGLVLS 65 >ref|XP_006438225.1| hypothetical protein CICLE_v10030867mg [Citrus clementina] gi|557540421|gb|ESR51465.1| hypothetical protein CICLE_v10030867mg [Citrus clementina] Length = 691 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/60 (55%), Positives = 42/60 (70%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+RVVF+ ILSE+QK EGL + W+L +P +SD+A YLLR F L S PHGL+LS Sbjct: 6 RVRVVFEGQHILSEAQKKEGLKKSWILFKPKHLKTISDLADYLLRIFHLHHSSPHGLVLS 65 >ref|XP_006438224.1| hypothetical protein CICLE_v10030867mg [Citrus clementina] gi|557540420|gb|ESR51464.1| hypothetical protein CICLE_v10030867mg [Citrus clementina] Length = 689 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/60 (55%), Positives = 42/60 (70%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+RVVF+ ILSE+QK EGL + W+L +P +SD+A YLLR F L S PHGL+LS Sbjct: 6 RVRVVFEGQHILSEAQKKEGLKKSWILFKPKHLKTISDLADYLLRIFHLHHSSPHGLVLS 65 >ref|XP_002282307.2| PREDICTED: uncharacterized protein LOC100256103 [Vitis vinifera] Length = 757 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/60 (55%), Positives = 46/60 (76%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+RVV ++ D+L+++Q EGL R W+LL+P QH +SD++SYLLR F L CP+GLLLS Sbjct: 7 RVRVVLEDPDLLNKTQNSEGLRRSWLLLKP-QHKTISDLSSYLLRIFNLHDFCPNGLLLS 65 >emb|CBI16805.3| unnamed protein product [Vitis vinifera] Length = 652 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/60 (55%), Positives = 46/60 (76%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+RVV ++ D+L+++Q EGL R W+LL+P QH +SD++SYLLR F L CP+GLLLS Sbjct: 7 RVRVVLEDPDLLNKTQNSEGLRRSWLLLKP-QHKTISDLSSYLLRIFNLHDFCPNGLLLS 65 >ref|XP_007044844.1| Sphere organelles protein-related, putative isoform 2 [Theobroma cacao] gi|508708779|gb|EOY00676.1| Sphere organelles protein-related, putative isoform 2 [Theobroma cacao] Length = 449 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/60 (51%), Positives = 48/60 (80%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+R++F++ +IL++SQK +GL R W+LL+P QH + D++S+LL F L +SCPHGL+LS Sbjct: 5 RLRLLFEDRNILNKSQKKQGLKRSWILLKP-QHQTILDLSSHLLYVFHLHRSCPHGLILS 63 >ref|XP_007044843.1| Sphere organelles protein-related, putative isoform 1 [Theobroma cacao] gi|508708778|gb|EOY00675.1| Sphere organelles protein-related, putative isoform 1 [Theobroma cacao] Length = 640 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/60 (51%), Positives = 48/60 (80%) Frame = +3 Query: 117 RIRVVFKEDDILSESQKLEGLSRCWVLLEPHQHDAVSDVASYLLRSFQLEQSCPHGLLLS 296 R+R++F++ +IL++SQK +GL R W+LL+P QH + D++S+LL F L +SCPHGL+LS Sbjct: 5 RLRLLFEDRNILNKSQKKQGLKRSWILLKP-QHQTILDLSSHLLYVFHLHRSCPHGLILS 63