BLASTX nr result
ID: Mentha29_contig00029362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00029362 (733 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS62043.1| hypothetical protein M569_12751, partial [Genlise... 60 8e-07 >gb|EPS62043.1| hypothetical protein M569_12751, partial [Genlisea aurea] Length = 358 Score = 60.1 bits (144), Expect = 8e-07 Identities = 38/98 (38%), Positives = 52/98 (53%), Gaps = 13/98 (13%) Frame = -3 Query: 365 DELEMMHDTSFLHEKPPRNCAESAKGAERKKEGSSSMNISRKADNGQ---------FTEE 213 ++LEMM SF++ KPP AESAK AE E +++N A + Q E Sbjct: 93 EKLEMMRAVSFMYVKPPGYDAESAKAAEISSENRNTVNHEENASHSQEPSAEGPASMKVE 152 Query: 212 KTKPLQKDAYG----GEEQSEGIDNAPRLDAGVSGGAK 111 K K KD +G EEQ + + NAP+LD GV+G +K Sbjct: 153 KKKSRPKDVFGRALPTEEQFQILKNAPKLDTGVAGRSK 190