BLASTX nr result
ID: Mentha29_contig00029361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00029361 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33640.1| hypothetical protein MIMGU_mgv1a002468mg [Mimulus... 53 8e-06 >gb|EYU33640.1| hypothetical protein MIMGU_mgv1a002468mg [Mimulus guttatus] Length = 670 Score = 53.1 bits (126), Expect(2) = 8e-06 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 2/42 (4%) Frame = -2 Query: 242 PNVKRSTRPETPLLRWTFDEGN--EKNIAAEEEKSSGEVDRR 123 P+ KRS+RPETPLLRW F+E N ++ EEEKSSGE R+ Sbjct: 54 PSAKRSSRPETPLLRWKFEEPNVQTNSVVEEEEKSSGEAGRK 95 Score = 21.9 bits (45), Expect(2) = 8e-06 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 117 AVVSSRKLAAGL 82 AVVS+RKL AGL Sbjct: 102 AVVSARKLGAGL 113