BLASTX nr result
ID: Mentha29_contig00029282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00029282 (409 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307143.1| ribonucleotide reductase large subunit B fam... 57 4e-06 gb|EYU23562.1| hypothetical protein MIMGU_mgv1a001491mg [Mimulus... 56 6e-06 >ref|XP_002307143.1| ribonucleotide reductase large subunit B family protein [Populus trichocarpa] gi|222856592|gb|EEE94139.1| ribonucleotide reductase large subunit B family protein [Populus trichocarpa] Length = 817 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/42 (64%), Positives = 33/42 (78%), Gaps = 6/42 (14%) Frame = +1 Query: 1 MLKDKK------ATVVAEDDDSKMSQVVCSLANRDDCLACGS 108 +L+DKK A A+DDD+KM+Q+VCSLANRDDCLACGS Sbjct: 776 VLQDKKLKSDGAAAAAADDDDTKMAQMVCSLANRDDCLACGS 817 >gb|EYU23562.1| hypothetical protein MIMGU_mgv1a001491mg [Mimulus guttatus] Length = 809 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 1 MLKDKKATVVAEDDDSKMSQVVCSLANRDDCLACGS 108 M+KDK A V EDD+SK+ Q+VCSL NRDDCLACGS Sbjct: 775 MIKDKPAVKV-EDDNSKLEQIVCSLTNRDDCLACGS 809