BLASTX nr result
ID: Mentha29_contig00029250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00029250 (474 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511756.1| F-box and wd40 domain protein, putative [Ric... 56 4e-06 >ref|XP_002511756.1| F-box and wd40 domain protein, putative [Ricinus communis] gi|223548936|gb|EEF50425.1| F-box and wd40 domain protein, putative [Ricinus communis] Length = 550 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = -3 Query: 160 VTTARRESVFARIGGKPAPLRINQVCTFWLQGRCNRNPCRYLHREVLP 17 +TT VF G +PA R N VC FW G+CNRNPCR+LHR++LP Sbjct: 5 ITTRTNHRVF---GQRPATSR-NSVCRFWKAGKCNRNPCRFLHRDLLP 48