BLASTX nr result
ID: Mentha29_contig00029248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00029248 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB82663.1| Zinc finger MYND domain-containing protein 15 [Mo... 59 5e-07 gb|EYU28653.1| hypothetical protein MIMGU_mgv1a008509mg [Mimulus... 58 2e-06 >gb|EXB82663.1| Zinc finger MYND domain-containing protein 15 [Morus notabilis] Length = 374 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = +3 Query: 48 RNEHLLGMWMFDCSCGVVSSSSFDHPSLISSWDLPSKLCPCR 173 RN H LGMW+++C CG S +SFD LI SWDLP LCPC+ Sbjct: 87 RNIHQLGMWLYECHCGT-SLASFDSSRLIDSWDLPDILCPCK 127 >gb|EYU28653.1| hypothetical protein MIMGU_mgv1a008509mg [Mimulus guttatus] Length = 371 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +3 Query: 57 HLLGMWMFDCSCGVVSSSSFDHPSLISSWDLPSKLCPCRG 176 H LGMWM +CSCG+ SS+FD+ L + W+LPS LCPC+G Sbjct: 86 HHLGMWMCECSCGI--SSTFDNLRLTNCWNLPSDLCPCKG 123