BLASTX nr result
ID: Mentha29_contig00029112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00029112 (592 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006293129.1| hypothetical protein CARUB_v10019435mg [Caps... 40 2e-08 >ref|XP_006293129.1| hypothetical protein CARUB_v10019435mg [Capsella rubella] gi|482561836|gb|EOA26027.1| hypothetical protein CARUB_v10019435mg [Capsella rubella] Length = 595 Score = 40.4 bits (93), Expect(3) = 2e-08 Identities = 27/79 (34%), Positives = 36/79 (45%), Gaps = 17/79 (21%) Frame = +2 Query: 212 GSRPAFSPGPQA----SSQPTTVPTRQPLPARTATTD-------------RCFSCGESGH 340 GSR F PQ+ +S + TR+ + A D RCFSCGE+GH Sbjct: 409 GSRSRFQSQPQSEIANTSNTESTSTRKIVSKTGANVDSIAASRQPRTSALRCFSCGENGH 468 Query: 341 RRATCPKATSIRAFLSEIT 397 R+ CP T R L++ T Sbjct: 469 RQTACPNQTR-RGLLAQET 486 Score = 39.7 bits (91), Expect(3) = 2e-08 Identities = 21/46 (45%), Positives = 27/46 (58%) Frame = +1 Query: 37 ISRTDTRETMEQLVCCYIGGLREPFQDMLNIFAPATVSEVHQKSSP 174 ++RT E +QLV +IGGLR Q L F P +VSE HQ + P Sbjct: 351 VARTTLLEAEDQLVSRFIGGLRTQLQLPLQQFNPTSVSEAHQCALP 396 Score = 23.5 bits (49), Expect(3) = 2e-08 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +3 Query: 3 FLPFNYMHTLFHK 41 FLP+NY TL++K Sbjct: 317 FLPYNYERTLYNK 329