BLASTX nr result
ID: Mentha29_contig00028742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00028742 (664 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41535.1| hypothetical protein MIMGU_mgv1a007318mg [Mimulus... 66 9e-09 gb|EYU41536.1| hypothetical protein MIMGU_mgv1a024772mg [Mimulus... 60 6e-07 >gb|EYU41535.1| hypothetical protein MIMGU_mgv1a007318mg [Mimulus guttatus] Length = 411 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +1 Query: 559 QHITTFRMGSNRAAINAVVDLGGPFLWFSCNDYSS 663 Q TT MGSNRAAIN V+DLGGPFLWFSCNDYSS Sbjct: 39 QFYTTIHMGSNRAAINTVIDLGGPFLWFSCNDYSS 73 >gb|EYU41536.1| hypothetical protein MIMGU_mgv1a024772mg [Mimulus guttatus] Length = 419 Score = 60.1 bits (144), Expect = 6e-07 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +1 Query: 559 QHITTFRMGSNRAAINAVVDLGGPFLWFSCNDYSS 663 Q+ TT MGSNR+ IN ++D+GGP+LWFSCNDY S Sbjct: 41 QYYTTITMGSNRSPINVIIDIGGPYLWFSCNDYKS 75