BLASTX nr result
ID: Mentha29_contig00028713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00028713 (248 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB65570.1| hypothetical protein L484_025836 [Morus notabilis] 83 5e-14 ref|XP_002535249.1| conserved hypothetical protein [Ricinus comm... 68 1e-09 ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago ... 65 7e-09 >gb|EXB65570.1| hypothetical protein L484_025836 [Morus notabilis] Length = 176 Score = 82.8 bits (203), Expect = 5e-14 Identities = 45/78 (57%), Positives = 52/78 (66%), Gaps = 21/78 (26%) Frame = -3 Query: 243 LAGAGVETSERALRERIVWRGEKFPVGVSDPPGIHLLVEEV------------------- 121 LAGAG+ETSERALRERIVWRGE+FPVGVS PPG+HL+VEE+ Sbjct: 60 LAGAGMETSERALRERIVWRGERFPVGVSGPPGLHLIVEELVPVRLFGTGRQPTYMKRRR 119 Query: 120 --GFLDMLVSRQ*KKGNS 73 GFLD+ VSR+ KK S Sbjct: 120 EGGFLDIKVSRRSKKATS 137 >ref|XP_002535249.1| conserved hypothetical protein [Ricinus communis] gi|223523659|gb|EEF27136.1| conserved hypothetical protein [Ricinus communis] Length = 55 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 139 VDTRRVGNPNGKLFTAPHDSFAKRSLRRFHSCPRKQ 246 V T+ GNPNGK FT PHDSFAKRSLRRFHSCPRKQ Sbjct: 1 VKTKGAGNPNGKPFTTPHDSFAKRSLRRFHSCPRKQ 36 >ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago truncatula] gi|355477353|gb|AES58556.1| hypothetical protein MTR_1g005670 [Medicago truncatula] Length = 250 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 243 LAGAGVETSERALRERIVWRGEKFPVGVSDPPGIHLLVEE 124 L G SERALRERIVWRGE+FPVGVS PPG+HL+VEE Sbjct: 125 LEDLGRSASERALRERIVWRGERFPVGVSGPPGLHLIVEE 164