BLASTX nr result
ID: Mentha29_contig00028698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00028698 (254 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006408292.1| hypothetical protein EUTSA_v10022279mg [Eutr... 67 3e-09 ref|XP_002524006.1| ring finger protein, putative [Ricinus commu... 67 3e-09 gb|EYU42290.1| hypothetical protein MIMGU_mgv1a009624mg [Mimulus... 66 4e-09 gb|EYU24462.1| hypothetical protein MIMGU_mgv1a019339mg [Mimulus... 66 4e-09 gb|EYU40283.1| hypothetical protein MIMGU_mgv1a026985mg [Mimulus... 66 6e-09 ref|XP_006287967.1| hypothetical protein CARUB_v10001202mg [Caps... 66 6e-09 ref|XP_006400302.1| hypothetical protein EUTSA_v10015712mg [Eutr... 65 7e-09 ref|XP_002266511.1| PREDICTED: RING-H2 finger protein ATL51 [Vit... 65 1e-08 ref|XP_006299622.1| hypothetical protein CARUB_v10015801mg [Caps... 64 2e-08 ref|XP_002884394.1| zinc finger family protein [Arabidopsis lyra... 64 2e-08 ref|XP_006354593.1| PREDICTED: RING-H2 finger protein ATL51-like... 64 3e-08 ref|XP_007218185.1| hypothetical protein PRUPE_ppa007682mg [Prun... 64 3e-08 ref|XP_004229518.1| PREDICTED: RING-H2 finger protein ATL51-like... 64 3e-08 ref|XP_007029812.1| RING/U-box superfamily protein, putative [Th... 60 2e-07 ref|NP_197262.1| RING-H2 finger protein ATL52 [Arabidopsis thali... 60 3e-07 dbj|BAE98353.1| RING-H2 zinc finger protein-like [Arabidopsis th... 60 3e-07 gb|AAF01602.1|AC009895_23 unknown protein [Arabidopsis thaliana] 59 5e-07 ref|NP_566208.1| RING-H2 finger protein ATL51 [Arabidopsis thali... 59 5e-07 gb|EPS71380.1| hypothetical protein M569_03379, partial [Genlise... 59 7e-07 ref|XP_007039473.1| RING/U-box superfamily protein, putative [Th... 59 9e-07 >ref|XP_006408292.1| hypothetical protein EUTSA_v10022279mg [Eutrema salsugineum] gi|557109438|gb|ESQ49745.1| hypothetical protein EUTSA_v10022279mg [Eutrema salsugineum] Length = 381 Score = 67.0 bits (162), Expect = 3e-09 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 MGS G+P+P PYD+Y DCS+G+CS YCPQ+CY+IFP Sbjct: 1 MGSTGNPNPWGPYDSYRDCSQGVCSVYCPQWCYVIFP 37 >ref|XP_002524006.1| ring finger protein, putative [Ricinus communis] gi|223536733|gb|EEF38374.1| ring finger protein, putative [Ricinus communis] Length = 323 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 MGSVG+ +P APYD Y DC++GICS YCPQ+CY+IFP Sbjct: 1 MGSVGNQNPWAPYDTYKDCTQGICSIYCPQWCYIIFP 37 >gb|EYU42290.1| hypothetical protein MIMGU_mgv1a009624mg [Mimulus guttatus] Length = 336 Score = 66.2 bits (160), Expect = 4e-09 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 MGS G+ +P APY+NY DC++G+CS YCPQFCY IFP Sbjct: 1 MGSAGNQNPWAPYNNYKDCTQGVCSIYCPQFCYFIFP 37 >gb|EYU24462.1| hypothetical protein MIMGU_mgv1a019339mg [Mimulus guttatus] Length = 335 Score = 66.2 bits (160), Expect = 4e-09 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 MGS G+ +P APY+NY DC++G+CS YCPQFCY IFP Sbjct: 1 MGSAGNQNPWAPYNNYKDCTQGVCSIYCPQFCYFIFP 37 >gb|EYU40283.1| hypothetical protein MIMGU_mgv1a026985mg [Mimulus guttatus] Length = 346 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 MGSV + +P PYD+Y DCS GICS YCPQFCYLIFP Sbjct: 6 MGSVANQNPYTPYDSYRDCSLGICSIYCPQFCYLIFP 42 >ref|XP_006287967.1| hypothetical protein CARUB_v10001202mg [Capsella rubella] gi|482556673|gb|EOA20865.1| hypothetical protein CARUB_v10001202mg [Capsella rubella] Length = 373 Score = 65.9 bits (159), Expect = 6e-09 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 MGS+ +P+P +PYD+Y DCS+GIC+ YCPQ+CYLIFP Sbjct: 1 MGSMSNPNPWSPYDSYNDCSQGICNVYCPQWCYLIFP 37 >ref|XP_006400302.1| hypothetical protein EUTSA_v10015712mg [Eutrema salsugineum] gi|557101392|gb|ESQ41755.1| hypothetical protein EUTSA_v10015712mg [Eutrema salsugineum] Length = 411 Score = 65.5 bits (158), Expect = 7e-09 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = +2 Query: 140 AMGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 +MGS +P+P PYD+Y DCS+G+C+ YCPQ+CYLIFP Sbjct: 35 SMGSTSNPNPWTPYDSYNDCSQGVCNIYCPQWCYLIFP 72 >ref|XP_002266511.1| PREDICTED: RING-H2 finger protein ATL51 [Vitis vinifera] gi|297744791|emb|CBI38059.3| unnamed protein product [Vitis vinifera] Length = 338 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIF 250 MGSVG+ DP APYD Y DCS+GIC+ YCPQ+CY+IF Sbjct: 1 MGSVGNSDPWAPYDGYRDCSQGICNEYCPQWCYIIF 36 >ref|XP_006299622.1| hypothetical protein CARUB_v10015801mg [Capsella rubella] gi|482568331|gb|EOA32520.1| hypothetical protein CARUB_v10015801mg [Capsella rubella] Length = 363 Score = 63.9 bits (154), Expect = 2e-08 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 MGS G+P+P YD+Y DCS+G+CS YCPQ+CY+IFP Sbjct: 1 MGSTGNPNPWGTYDSYRDCSQGVCSVYCPQWCYVIFP 37 >ref|XP_002884394.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297330234|gb|EFH60653.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 355 Score = 63.9 bits (154), Expect = 2e-08 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 MGS G+P+P YD+Y DCS+G+CS YCPQ+CY+IFP Sbjct: 1 MGSTGNPNPWGTYDSYRDCSQGVCSVYCPQWCYVIFP 37 >ref|XP_006354593.1| PREDICTED: RING-H2 finger protein ATL51-like [Solanum tuberosum] Length = 306 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 MGS+G+ +P APYD+Y DCS+GICS YCPQ+CY + P Sbjct: 1 MGSIGNTNPWAPYDSYKDCSQGICSVYCPQWCYFLLP 37 >ref|XP_007218185.1| hypothetical protein PRUPE_ppa007682mg [Prunus persica] gi|462414647|gb|EMJ19384.1| hypothetical protein PRUPE_ppa007682mg [Prunus persica] Length = 359 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 MGS G+ +P APYDNY DCS+GICS YCPQ+CY++ P Sbjct: 1 MGSSGNQNPWAPYDNYKDCSQGICSIYCPQWCYILGP 37 >ref|XP_004229518.1| PREDICTED: RING-H2 finger protein ATL51-like [Solanum lycopersicum] Length = 307 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 MGS+G+ +P APYD+Y DCS+GICS YCPQ+CY + P Sbjct: 1 MGSIGNTNPWAPYDSYKDCSQGICSVYCPQWCYFLLP 37 >ref|XP_007029812.1| RING/U-box superfamily protein, putative [Theobroma cacao] gi|508718417|gb|EOY10314.1| RING/U-box superfamily protein, putative [Theobroma cacao] Length = 372 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +2 Query: 149 SVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 S P+P PYD Y DCS+G+CS YCPQ+CYLIFP Sbjct: 4 SASTPNPWTPYDTYKDCSQGLCSIYCPQWCYLIFP 38 >ref|NP_197262.1| RING-H2 finger protein ATL52 [Arabidopsis thaliana] gi|68565306|sp|Q9LF64.1|ATL52_ARATH RecName: Full=RING-H2 finger protein ATL52 gi|9755785|emb|CAC01904.1| RING-H2 zinc finger protein-like [Arabidopsis thaliana] gi|332005064|gb|AED92447.1| RING-H2 finger protein ATL52 [Arabidopsis thaliana] Length = 362 Score = 60.1 bits (144), Expect = 3e-07 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +2 Query: 158 DPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 +P+P +PYD+Y DCS+GIC+ YCPQ+CYLIFP Sbjct: 4 NPNPWSPYDSYNDCSQGICNIYCPQWCYLIFP 35 >dbj|BAE98353.1| RING-H2 zinc finger protein-like [Arabidopsis thaliana] Length = 348 Score = 60.1 bits (144), Expect = 3e-07 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +2 Query: 158 DPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 +P+P +PYD+Y DCS+GIC+ YCPQ+CYLIFP Sbjct: 4 NPNPWSPYDSYNDCSQGICNIYCPQWCYLIFP 35 >gb|AAF01602.1|AC009895_23 unknown protein [Arabidopsis thaliana] Length = 291 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/38 (63%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +2 Query: 143 MGSVGDPDP*AP-YDNYIDCSRGICSFYCPQFCYLIFP 253 MGS G+P+P YD+Y DCS+G+CS YCPQ+CY+IFP Sbjct: 1 MGSTGNPNPWGTTYDSYRDCSQGVCSVYCPQWCYVIFP 38 >ref|NP_566208.1| RING-H2 finger protein ATL51 [Arabidopsis thaliana] gi|68565340|sp|Q9SRQ8.2|ATL51_ARATH RecName: Full=RING-H2 finger protein ATL51 gi|6091769|gb|AAF03479.1|AC009327_18 unknown protein [Arabidopsis thaliana] gi|21553595|gb|AAM62688.1| RING-H2 zinc finger protein-like [Arabidopsis thaliana] gi|30102646|gb|AAP21241.1| At3g03550 [Arabidopsis thaliana] gi|110736072|dbj|BAF00009.1| hypothetical protein [Arabidopsis thaliana] gi|332640435|gb|AEE73956.1| RING-H2 finger protein ATL51 [Arabidopsis thaliana] Length = 356 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/38 (63%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +2 Query: 143 MGSVGDPDP*AP-YDNYIDCSRGICSFYCPQFCYLIFP 253 MGS G+P+P YD+Y DCS+G+CS YCPQ+CY+IFP Sbjct: 1 MGSTGNPNPWGTTYDSYRDCSQGVCSVYCPQWCYVIFP 38 >gb|EPS71380.1| hypothetical protein M569_03379, partial [Genlisea aurea] Length = 212 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 MGSVG +P APYD +C+ +CS YCPQFCYLIFP Sbjct: 1 MGSVGSQNPWAPYDAAKECTPDVCSIYCPQFCYLIFP 37 >ref|XP_007039473.1| RING/U-box superfamily protein, putative [Theobroma cacao] gi|508776718|gb|EOY23974.1| RING/U-box superfamily protein, putative [Theobroma cacao] Length = 370 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +2 Query: 143 MGSVGDPDP*APYDNYIDCSRGICSFYCPQFCYLIFP 253 MGS+G+P PY N DCS+G CS YCPQ+CY+IFP Sbjct: 1 MGSIGNPRTWVPYMNTKDCSQGFCSLYCPQWCYIIFP 37