BLASTX nr result
ID: Mentha29_contig00028561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00028561 (217 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35156.1| hypothetical protein MIMGU_mgv1a026240mg [Mimulus... 56 5e-06 ref|XP_006399077.1| hypothetical protein EUTSA_v10014078mg [Eutr... 56 5e-06 >gb|EYU35156.1| hypothetical protein MIMGU_mgv1a026240mg [Mimulus guttatus] Length = 335 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 215 SSFFRKGEVGDSKNYLTPEMEMQIDQTILLKLEGIG 108 SS+FRKGEVGDSKNYLT EME +ID+T LKLE G Sbjct: 297 SSYFRKGEVGDSKNYLTAEMERRIDETSRLKLEPFG 332 >ref|XP_006399077.1| hypothetical protein EUTSA_v10014078mg [Eutrema salsugineum] gi|557100167|gb|ESQ40530.1| hypothetical protein EUTSA_v10014078mg [Eutrema salsugineum] Length = 332 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 209 FFRKGEVGDSKNYLTPEMEMQIDQTILLKLEGIG 108 FFRKGEVGDSKNYLTPEME +ID+ + KLEG G Sbjct: 296 FFRKGEVGDSKNYLTPEMESRIDKIVREKLEGSG 329