BLASTX nr result
ID: Mentha29_contig00028247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00028247 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24991.1| hypothetical protein MIMGU_mgv1a013141mg [Mimulus... 65 1e-08 ref|XP_004234943.1| PREDICTED: chloride conductance regulatory p... 60 4e-07 gb|EPS58770.1| hypothetical protein M569_16042, partial [Genlise... 56 6e-06 >gb|EYU24991.1| hypothetical protein MIMGU_mgv1a013141mg [Mimulus guttatus] Length = 229 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/46 (69%), Positives = 34/46 (73%), Gaps = 4/46 (8%) Frame = +1 Query: 1 EWADHQNPAHPIGANGNLDLAHSVVQLQINDHRFEDA----EDDKN 126 +WA QNP H IGANG DL HSVVQLQIND RFEDA +DDKN Sbjct: 181 DWAFAQNPGHSIGANGTHDLVHSVVQLQINDQRFEDADEMVQDDKN 226 >ref|XP_004234943.1| PREDICTED: chloride conductance regulatory protein ICln-like [Solanum lycopersicum] Length = 230 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 5/50 (10%) Frame = +1 Query: 1 EWADHQNPAHPIG-ANGNLDLAHSVVQLQINDHRFEDAE----DDKNSDH 135 EW QN HPIG +NG+ DLAH+V+QLQIND RFEDAE D KN H Sbjct: 179 EWLISQNSTHPIGHSNGDHDLAHNVLQLQINDQRFEDAEEMDSDSKNGHH 228 >gb|EPS58770.1| hypothetical protein M569_16042, partial [Genlisea aurea] Length = 219 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +1 Query: 1 EWADHQNPAHPIGANGNLDLAHSVVQLQINDHRFEDAED 117 E DH+N H IG NGN DLA SVVQL+I+D RFEDAE+ Sbjct: 181 ELVDHRNATHSIGENGNRDLAGSVVQLRIDDQRFEDAEE 219