BLASTX nr result
ID: Mentha29_contig00026972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00026972 (205 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS65053.1| hypothetical protein M569_09725 [Genlisea aurea] 59 9e-07 >gb|EPS65053.1| hypothetical protein M569_09725 [Genlisea aurea] Length = 397 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/58 (56%), Positives = 42/58 (72%), Gaps = 3/58 (5%) Frame = +2 Query: 41 MALSRRFQSSMLLHRRLFSSS---GNNAAFVGSKEQSRAALSLIRFEQNPERILDICR 205 MAL +S+ L RLFS+S ++ + SKE+SRAALSL+RFE+NPERILDICR Sbjct: 1 MALRSTIRSAYLWRCRLFSTSILNSDSKTPLSSKEKSRAALSLLRFEKNPERILDICR 58