BLASTX nr result
ID: Mentha29_contig00026875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00026875 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22124.1| hypothetical protein MIMGU_mgv1a0097521mg [Mimulu... 74 2e-11 >gb|EYU22124.1| hypothetical protein MIMGU_mgv1a0097521mg [Mimulus guttatus] Length = 332 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 213 MSFLTFITGSTKSWQPAMTVNTTTAAYWLN*RVLLCSL 326 MSFLTFITGSTKSWQPAMTV+TTTA+YWLN RVLLCS+ Sbjct: 1 MSFLTFITGSTKSWQPAMTVDTTTASYWLNWRVLLCSI 38