BLASTX nr result
ID: Mentha29_contig00026701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00026701 (826 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24512.1| hypothetical protein MIMGU_mgv1a000585mg [Mimulus... 52 1e-07 >gb|EYU24512.1| hypothetical protein MIMGU_mgv1a000585mg [Mimulus guttatus] Length = 1057 Score = 51.6 bits (122), Expect(2) = 1e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +1 Query: 694 GKHLKSEEQPSKLENSDKVLQGKLRSHPHF 783 G+H+K EEQP +LENSDKV+QGKLR+HP F Sbjct: 831 GEHVKFEEQPQELENSDKVMQGKLRTHPLF 860 Score = 31.2 bits (69), Expect(2) = 1e-07 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 774 PTFFAITMCLLQEIINS 824 P FFAITM LLQEIINS Sbjct: 858 PLFFAITMGLLQEIINS 874