BLASTX nr result
ID: Mentha29_contig00026661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00026661 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004154455.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 59 7e-07 ref|XP_004139637.1| PREDICTED: uncharacterized protein LOC101204... 59 7e-07 >ref|XP_004154455.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101204360 [Cucumis sativus] Length = 1370 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +3 Query: 117 MGRKKPTTRDDESAPAXXXXXXXX----FAIADDEYSMGPELSEESVVTEEKV 263 MGRKKPT RDD+SAPA FA+ DDEYS+G ELSEE+ + EEKV Sbjct: 1 MGRKKPTARDDDSAPAAAHGGGKSKKKTFAVDDDEYSIGTELSEEAQIQEEKV 53 >ref|XP_004139637.1| PREDICTED: uncharacterized protein LOC101204360 [Cucumis sativus] Length = 1370 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = +3 Query: 117 MGRKKPTTRDDESAPAXXXXXXXX----FAIADDEYSMGPELSEESVVTEEKV 263 MGRKKPT RDD+SAPA FA+ DDEYS+G ELSEE+ + EEKV Sbjct: 1 MGRKKPTARDDDSAPAAAHGGGKSKKKTFAVDDDEYSIGTELSEEAQIQEEKV 53