BLASTX nr result
ID: Mentha29_contig00026626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00026626 (545 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_976233.2| PREDICTED: hypothetical protein [Tribolium cast... 57 4e-06 gb|EFA11953.1| hypothetical protein TcasGA2_TC008553 [Tribolium ... 57 4e-06 >ref|XP_976233.2| PREDICTED: hypothetical protein [Tribolium castaneum] Length = 602 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/45 (48%), Positives = 35/45 (77%) Frame = +2 Query: 164 GTAYSKNIHYENRPVVTGYSSSIIKPDLGSIATPLQTVSQQRVAA 298 GTAY+KN+H+ + VVTGY+S I KP+L ++ATP++ ++ +AA Sbjct: 195 GTAYTKNVHFAEKDVVTGYTSHIYKPNLAALATPVEAIAHHEIAA 239 >gb|EFA11953.1| hypothetical protein TcasGA2_TC008553 [Tribolium castaneum] Length = 499 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/45 (48%), Positives = 35/45 (77%) Frame = +2 Query: 164 GTAYSKNIHYENRPVVTGYSSSIIKPDLGSIATPLQTVSQQRVAA 298 GTAY+KN+H+ + VVTGY+S I KP+L ++ATP++ ++ +AA Sbjct: 92 GTAYTKNVHFAEKDVVTGYTSHIYKPNLAALATPVEAIAHHEIAA 136