BLASTX nr result
ID: Mentha29_contig00026600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00026600 (855 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006351815.1| PREDICTED: glycine-rich RNA-binding protein ... 72 2e-10 ref|XP_004230614.1| PREDICTED: uncharacterized protein LOC101263... 72 2e-10 ref|XP_004136860.1| PREDICTED: uncharacterized protein LOC101215... 70 1e-09 gb|EPS72946.1| hypothetical protein M569_01808 [Genlisea aurea] 70 1e-09 gb|ACX71299.1| RNA-binding protein RZ-1 [Capsicum annuum] 70 1e-09 ref|XP_006341831.1| PREDICTED: glycine-rich RNA-binding protein ... 68 4e-09 ref|XP_006854598.1| hypothetical protein AMTR_s00030p00132070 [A... 68 5e-09 emb|CBI35498.3| unnamed protein product [Vitis vinifera] 67 7e-09 ref|XP_002523766.1| dc50, putative [Ricinus communis] gi|2235369... 67 7e-09 ref|XP_002264022.1| PREDICTED: uncharacterized protein LOC100256... 67 7e-09 ref|XP_004248805.1| PREDICTED: uncharacterized protein LOC101246... 67 1e-08 dbj|BAA12064.1| RNA-binding protein RZ-1 [Nicotiana sylvestris] ... 66 1e-08 ref|XP_002299678.2| hypothetical protein POPTR_0001s21460g [Popu... 65 3e-08 ref|XP_007037359.1| RNA-binding family protein with retrovirus z... 65 3e-08 ref|XP_007037358.1| RNA-binding family protein with retrovirus z... 65 3e-08 ref|XP_006291770.1| hypothetical protein CARUB_v10017941mg [Caps... 64 6e-08 ref|XP_002875318.1| predicted protein [Arabidopsis lyrata subsp.... 64 6e-08 ref|XP_004504757.1| PREDICTED: glycine-rich RNA-binding protein-... 64 7e-08 ref|XP_003593133.1| Glycine-rich RNA-binding protein [Medicago t... 64 7e-08 ref|NP_189273.1| zinc finger-containing glycine-rich RNA-bindin... 63 1e-07 >ref|XP_006351815.1| PREDICTED: glycine-rich RNA-binding protein GRP2A-like isoform X1 [Solanum tuberosum] gi|565370415|ref|XP_006351816.1| PREDICTED: glycine-rich RNA-binding protein GRP2A-like isoform X2 [Solanum tuberosum] Length = 205 Score = 72.4 bits (176), Expect = 2e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M ++DE+RCFIGNLSWSTSDRGLK AFEKFGHLV+AK Sbjct: 1 MSEEDEYRCFIGNLSWSTSDRGLKDAFEKFGHLVDAK 37 >ref|XP_004230614.1| PREDICTED: uncharacterized protein LOC101263853 isoform 1 [Solanum lycopersicum] gi|460369530|ref|XP_004230615.1| PREDICTED: uncharacterized protein LOC101263853 isoform 2 [Solanum lycopersicum] Length = 202 Score = 72.4 bits (176), Expect = 2e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M ++DE+RCFIGNLSWSTSDRGLK AFEKFGHLV+AK Sbjct: 1 MSEEDEYRCFIGNLSWSTSDRGLKDAFEKFGHLVDAK 37 >ref|XP_004136860.1| PREDICTED: uncharacterized protein LOC101215898 [Cucumis sativus] gi|449478936|ref|XP_004155458.1| PREDICTED: uncharacterized protein LOC101227324 [Cucumis sativus] Length = 211 Score = 70.1 bits (170), Expect = 1e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M D+ E+RCFIG LSWSTSDRGLK+AFEKFGHLVEAK Sbjct: 1 MADEVEYRCFIGGLSWSTSDRGLKEAFEKFGHLVEAK 37 >gb|EPS72946.1| hypothetical protein M569_01808 [Genlisea aurea] Length = 256 Score = 69.7 bits (169), Expect = 1e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M +DE+RCF+GNLSWSTSDR LK+AFEKFGHLV+AK Sbjct: 1 MSQEDEYRCFVGNLSWSTSDRNLKEAFEKFGHLVDAK 37 >gb|ACX71299.1| RNA-binding protein RZ-1 [Capsicum annuum] Length = 202 Score = 69.7 bits (169), Expect = 1e-09 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M ++DE+RCFIGNLSWSTSDRGLK AFEKFG+LV+AK Sbjct: 1 MSEEDEYRCFIGNLSWSTSDRGLKDAFEKFGNLVDAK 37 >ref|XP_006341831.1| PREDICTED: glycine-rich RNA-binding protein 7-like isoform X1 [Solanum tuberosum] gi|565349710|ref|XP_006341832.1| PREDICTED: glycine-rich RNA-binding protein 7-like isoform X2 [Solanum tuberosum] Length = 214 Score = 68.2 bits (165), Expect = 4e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 MG+ DE+RCFIGNLSWSTSDRGLK AF KFG+L++AK Sbjct: 1 MGEDDEYRCFIGNLSWSTSDRGLKDAFRKFGNLLDAK 37 >ref|XP_006854598.1| hypothetical protein AMTR_s00030p00132070 [Amborella trichopoda] gi|548858284|gb|ERN16065.1| hypothetical protein AMTR_s00030p00132070 [Amborella trichopoda] Length = 223 Score = 67.8 bits (164), Expect = 5e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +1 Query: 742 NMGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 +MG+ E+RCFIG LSWSTSDRGL++AFEKFGHLV+AK Sbjct: 51 DMGEAMEYRCFIGGLSWSTSDRGLREAFEKFGHLVDAK 88 >emb|CBI35498.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 67.4 bits (163), Expect = 7e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M + +E+RCFIG LSWSTSDR LK+AFEKFGHLVEAK Sbjct: 1 MSEHEEYRCFIGGLSWSTSDRSLKEAFEKFGHLVEAK 37 >ref|XP_002523766.1| dc50, putative [Ricinus communis] gi|223536978|gb|EEF38615.1| dc50, putative [Ricinus communis] Length = 210 Score = 67.4 bits (163), Expect = 7e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M ++ E+RCFIG LSWSTSDRGLK+AFEKFGHL+EAK Sbjct: 1 MSEEVEYRCFIGGLSWSTSDRGLKEAFEKFGHLLEAK 37 >ref|XP_002264022.1| PREDICTED: uncharacterized protein LOC100256416 isoform 1 [Vitis vinifera] gi|359493015|ref|XP_003634493.1| PREDICTED: uncharacterized protein LOC100256416 isoform 2 [Vitis vinifera] Length = 207 Score = 67.4 bits (163), Expect = 7e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M + +E+RCFIG LSWSTSDR LK+AFEKFGHLVEAK Sbjct: 1 MSEHEEYRCFIGGLSWSTSDRSLKEAFEKFGHLVEAK 37 >ref|XP_004248805.1| PREDICTED: uncharacterized protein LOC101246099 [Solanum lycopersicum] Length = 214 Score = 66.6 bits (161), Expect = 1e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 MG+ DE+RCFIGNLSWSTS+RGLK AF KFG+L++AK Sbjct: 1 MGEDDEYRCFIGNLSWSTSERGLKDAFRKFGNLLDAK 37 >dbj|BAA12064.1| RNA-binding protein RZ-1 [Nicotiana sylvestris] gi|1435062|dbj|BAA06012.1| RNA binding protein RZ-1 [Nicotiana sylvestris] Length = 209 Score = 66.2 bits (160), Expect = 1e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 757 DEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 DE+RCFIGNLSWSTSDRGLK AFEKFG+LV+AK Sbjct: 4 DEYRCFIGNLSWSTSDRGLKDAFEKFGNLVDAK 36 >ref|XP_002299678.2| hypothetical protein POPTR_0001s21460g [Populus trichocarpa] gi|550347818|gb|EEE84483.2| hypothetical protein POPTR_0001s21460g [Populus trichocarpa] Length = 215 Score = 65.5 bits (158), Expect = 3e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M ++ E+RCFIG LSWSTSDRGLK+ FEKFGHL+EAK Sbjct: 1 MSEELEYRCFIGGLSWSTSDRGLKETFEKFGHLLEAK 37 >ref|XP_007037359.1| RNA-binding family protein with retrovirus zinc finger-like domain isoform 2 [Theobroma cacao] gi|508774604|gb|EOY21860.1| RNA-binding family protein with retrovirus zinc finger-like domain isoform 2 [Theobroma cacao] Length = 215 Score = 65.5 bits (158), Expect = 3e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M ++ E+RCFIGNLSWSTSDRGLK AFEKFG+L+EAK Sbjct: 1 MPEEVEYRCFIGNLSWSTSDRGLKDAFEKFGNLLEAK 37 >ref|XP_007037358.1| RNA-binding family protein with retrovirus zinc finger-like domain isoform 1 [Theobroma cacao] gi|508774603|gb|EOY21859.1| RNA-binding family protein with retrovirus zinc finger-like domain isoform 1 [Theobroma cacao] Length = 208 Score = 65.5 bits (158), Expect = 3e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M ++ E+RCFIGNLSWSTSDRGLK AFEKFG+L+EAK Sbjct: 1 MPEEVEYRCFIGNLSWSTSDRGLKDAFEKFGNLLEAK 37 >ref|XP_006291770.1| hypothetical protein CARUB_v10017941mg [Capsella rubella] gi|565467782|ref|XP_006291771.1| hypothetical protein CARUB_v10017941mg [Capsella rubella] gi|482560477|gb|EOA24668.1| hypothetical protein CARUB_v10017941mg [Capsella rubella] gi|482560478|gb|EOA24669.1| hypothetical protein CARUB_v10017941mg [Capsella rubella] Length = 241 Score = 64.3 bits (155), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M + EFRCFIG L+WSTSDRGL+ AFEK+GHL+EAK Sbjct: 1 MSEDPEFRCFIGGLAWSTSDRGLRDAFEKYGHLLEAK 37 >ref|XP_002875318.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297321156|gb|EFH51577.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 247 Score = 64.3 bits (155), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M + E+RCFIG L+WSTSDRGL+ AFEK+GHLVEAK Sbjct: 1 MSEDPEYRCFIGGLAWSTSDRGLRDAFEKYGHLVEAK 37 >ref|XP_004504757.1| PREDICTED: glycine-rich RNA-binding protein-like isoform X1 [Cicer arietinum] Length = 212 Score = 63.9 bits (154), Expect = 7e-08 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +1 Query: 736 QLNMGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 Q M D+DE+RCFIG L+WSTSDR LK FEKFG L EAK Sbjct: 2 QFKMSDEDEYRCFIGGLAWSTSDRKLKDTFEKFGKLTEAK 41 >ref|XP_003593133.1| Glycine-rich RNA-binding protein [Medicago truncatula] gi|355482181|gb|AES63384.1| Glycine-rich RNA-binding protein [Medicago truncatula] Length = 491 Score = 63.9 bits (154), Expect = 7e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M D DEFRCFIG L+WSTSDR LK AFEK+G LVEAK Sbjct: 223 MSDTDEFRCFIGGLAWSTSDRRLKDAFEKYGKLVEAK 259 >ref|NP_189273.1| zinc finger-containing glycine-rich RNA-binding protein [Arabidopsis thaliana] gi|15983477|gb|AAL11606.1|AF424613_1 AT3g26420/F20C19_14 [Arabidopsis thaliana] gi|9294301|dbj|BAB02203.1| unnamed protein product [Arabidopsis thaliana] gi|15451066|gb|AAK96804.1| Unknown protein [Arabidopsis thaliana] gi|18377412|gb|AAL66872.1| unknown protein [Arabidopsis thaliana] gi|62320797|dbj|BAD93728.1| RNA-binding protein [Arabidopsis thaliana] gi|110742443|dbj|BAE99140.1| putative RNA-binding protein [Arabidopsis thaliana] gi|332643635|gb|AEE77156.1| zinc finger-containing glycine-rich RNA-binding protein [Arabidopsis thaliana] Length = 245 Score = 63.2 bits (152), Expect = 1e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +1 Query: 745 MGDQDEFRCFIGNLSWSTSDRGLKQAFEKFGHLVEAK 855 M + E+RCFIG L+W+TSDRGL+ AFEK+GHLVEAK Sbjct: 1 MSEDPEYRCFIGGLAWTTSDRGLRDAFEKYGHLVEAK 37