BLASTX nr result
ID: Mentha29_contig00026567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00026567 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK36093.1| unknown [Lotus japonicus] 48 8e-06 ref|XP_002509539.1| ribulose-5-phosphate-3-epimerase, putative [... 47 8e-06 >gb|AFK36093.1| unknown [Lotus japonicus] Length = 226 Score = 47.8 bits (112), Expect(2) = 8e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -1 Query: 150 SNPLDYVEPLGKAGAFGFTFHMGAS 76 +NPLDYVEPLGKAGA GFTFH+ AS Sbjct: 72 TNPLDYVEPLGKAGASGFTFHVEAS 96 Score = 27.3 bits (59), Expect(2) = 8e-06 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -3 Query: 310 HFVPNHTIGGPVIS--REFEKARIVNCRFHLTS 218 HFVPN TIG PVI R+ KA ++C +T+ Sbjct: 42 HFVPNLTIGTPVIESLRKHTKA-YLDCHLMVTN 73 >ref|XP_002509539.1| ribulose-5-phosphate-3-epimerase, putative [Ricinus communis] gi|223549438|gb|EEF50926.1| ribulose-5-phosphate-3-epimerase, putative [Ricinus communis] Length = 226 Score = 47.0 bits (110), Expect(2) = 8e-06 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -1 Query: 150 SNPLDYVEPLGKAGAFGFTFHMGAS 76 +NP+DYVEPLGKAGA GFTFH+ AS Sbjct: 72 TNPIDYVEPLGKAGASGFTFHVEAS 96 Score = 28.1 bits (61), Expect(2) = 8e-06 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -3 Query: 310 HFVPNHTIGGPVIS--REFEKARIVNCRFHLTS 218 HFVPN TIG PVI R+ KA ++C +T+ Sbjct: 42 HFVPNLTIGAPVIESLRKHTKA-YLDCHLMVTN 73