BLASTX nr result
ID: Mentha29_contig00025997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00025997 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB37120.1| hypothetical protein L484_018543 [Morus notabilis] 70 4e-10 >gb|EXB37120.1| hypothetical protein L484_018543 [Morus notabilis] Length = 240 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -1 Query: 211 GSSILFSSRELPDRRSIRNGLRVHFVGRKDPIHKHGNETKF 89 GSSILFSS+EL DRRSIRNGLRVHFVGRKDPIH +TKF Sbjct: 194 GSSILFSSQELLDRRSIRNGLRVHFVGRKDPIHSGNPKTKF 234