BLASTX nr result
ID: Mentha29_contig00025781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00025781 (244 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43083.1| hypothetical protein MIMGU_mgv1a025295mg, partial... 65 7e-09 >gb|EYU43083.1| hypothetical protein MIMGU_mgv1a025295mg, partial [Mimulus guttatus] Length = 113 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/64 (51%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Frame = +3 Query: 9 RKEAYEFSKQMPEVLQFKLVPSRPLVNNLFD-YIPDKNDIALYFFPGDGERCAFVQSWKM 185 R++ YEFSKQMP+V+ +LVP + + F+ Y P + DI LYFFPG GERCA V + Sbjct: 18 RRKIYEFSKQMPKVIHVQLVPLKKFWIDFFEEYTPYERDIGLYFFPGGGERCASVSCFDY 77 Query: 186 IILL 197 I LL Sbjct: 78 ISLL 81