BLASTX nr result
ID: Mentha29_contig00025697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00025697 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18763.1| hypothetical protein MIMGU_mgv1a014330mg [Mimulus... 58 1e-06 >gb|EYU18763.1| hypothetical protein MIMGU_mgv1a014330mg [Mimulus guttatus] Length = 193 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 1 VARLKNDPRATIYTLNTSNRDAMKEQIYSNLVDLLQ 108 VARLKN ATIYT+++SNRDAMK+QIYSNL DLLQ Sbjct: 156 VARLKNQTGATIYTVDSSNRDAMKDQIYSNLADLLQ 191