BLASTX nr result
ID: Mentha29_contig00025646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00025646 (260 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18150.1| hypothetical protein MIMGU_mgv1a015404mg [Mimulus... 64 2e-08 >gb|EYU18150.1| hypothetical protein MIMGU_mgv1a015404mg [Mimulus guttatus] Length = 158 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -1 Query: 260 AFESLSDDAEVIELERQMLEKFYGAGFWRSPSQKSETS 147 A ES+SDD+EVIELE++M +KFYGAGFWRSPSQ++E S Sbjct: 119 ALESVSDDSEVIELEKEMWDKFYGAGFWRSPSQRTEVS 156