BLASTX nr result
ID: Mentha29_contig00024213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00024213 (211 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33970.1| hypothetical protein MIMGU_mgv1a018989mg [Mimulus... 56 5e-06 gb|EYU33968.1| hypothetical protein MIMGU_mgv1a026820mg, partial... 56 6e-06 >gb|EYU33970.1| hypothetical protein MIMGU_mgv1a018989mg [Mimulus guttatus] Length = 895 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/55 (58%), Positives = 36/55 (65%) Frame = -1 Query: 166 ENLQTLKNIYNFKCSERVVKIIRNIKKLAIVLSDQKALDGDSLCLTNLDCLDKLE 2 ENLQTL I NFKCSE VVK I N+KKL + D + L S CL NL L+KLE Sbjct: 660 ENLQTLLQIRNFKCSEEVVKRIPNVKKLRLYYQDVEEL--SSFCLNNLCRLEKLE 712 >gb|EYU33968.1| hypothetical protein MIMGU_mgv1a026820mg, partial [Mimulus guttatus] Length = 880 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/55 (58%), Positives = 36/55 (65%) Frame = -1 Query: 166 ENLQTLKNIYNFKCSERVVKIIRNIKKLAIVLSDQKALDGDSLCLTNLDCLDKLE 2 ENLQTL I NFKCSE VVK I N+KKL + D + L S CL NL L+KLE Sbjct: 653 ENLQTLLQIRNFKCSEAVVKRIPNVKKLRLYYQDVEEL--SSFCLNNLCRLEKLE 705