BLASTX nr result
ID: Mentha29_contig00024202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00024202 (295 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018942.1| C-jun-amino-terminal kinase-interacting prot... 55 8e-06 >ref|XP_007018942.1| C-jun-amino-terminal kinase-interacting protein 3, putative [Theobroma cacao] gi|508724270|gb|EOY16167.1| C-jun-amino-terminal kinase-interacting protein 3, putative [Theobroma cacao] Length = 625 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 295 ENGGEDEGLTEEEINAFYQEYMNRRPSLEV 206 EN GEDEGLTEEEINAFYQEYM RPSL++ Sbjct: 564 ENSGEDEGLTEEEINAFYQEYMKLRPSLKL 593