BLASTX nr result
ID: Mentha29_contig00024093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00024093 (521 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006353896.1| PREDICTED: uncharacterized protein LOC102583... 65 1e-08 ref|XP_004234428.1| PREDICTED: uncharacterized protein LOC101260... 65 1e-08 gb|EXB93840.1| hypothetical protein L484_004326 [Morus notabilis] 60 3e-07 ref|XP_004245591.1| PREDICTED: uncharacterized protein LOC101254... 60 3e-07 ref|XP_006413289.1| hypothetical protein EUTSA_v10025027mg [Eutr... 60 4e-07 ref|XP_002509822.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 ref|XP_007038765.1| Hydroxyproline-rich glycoprotein family prot... 59 5e-07 ref|XP_006490432.1| PREDICTED: uncharacterized protein FLJ40925-... 59 9e-07 ref|XP_006343965.1| PREDICTED: uncharacterized protein At1g76660... 59 9e-07 ref|XP_006421977.1| hypothetical protein CICLE_v10004813mg [Citr... 59 9e-07 emb|CBI22685.3| unnamed protein product [Vitis vinifera] 59 9e-07 ref|XP_002272322.1| PREDICTED: uncharacterized protein LOC100264... 59 9e-07 ref|XP_007038766.1| Hydroxyproline-rich glycoprotein family prot... 57 2e-06 ref|XP_006476541.1| PREDICTED: uncharacterized protein LOC102626... 56 5e-06 ref|XP_004146564.1| PREDICTED: uncharacterized protein LOC101220... 56 5e-06 ref|XP_007040283.1| Hydroxyproline-rich glycoprotein family prot... 56 6e-06 ref|XP_006827570.1| hypothetical protein AMTR_s00009p00224560 [A... 55 8e-06 ref|XP_004157195.1| PREDICTED: uncharacterized protein LOC101225... 55 8e-06 ref|XP_004140832.1| PREDICTED: uncharacterized protein LOC101210... 55 8e-06 >ref|XP_006353896.1| PREDICTED: uncharacterized protein LOC102583548 [Solanum tuberosum] Length = 470 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QKRRWGSCWS+YWCFGS KHSKRIGHA Sbjct: 31 QKRRWGSCWSLYWCFGSHKHSKRIGHA 57 >ref|XP_004234428.1| PREDICTED: uncharacterized protein LOC101260903 [Solanum lycopersicum] Length = 470 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QKRRWGSCWS+YWCFGS KHSKRIGHA Sbjct: 31 QKRRWGSCWSLYWCFGSHKHSKRIGHA 57 >gb|EXB93840.1| hypothetical protein L484_004326 [Morus notabilis] Length = 521 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 80 KRRWGSCWSIYWCFGSCKHSKRIGHA 3 KRRWGSCWS+YWCFGS K+SKRIGHA Sbjct: 32 KRRWGSCWSLYWCFGSHKNSKRIGHA 57 >ref|XP_004245591.1| PREDICTED: uncharacterized protein LOC101254118 [Solanum lycopersicum] Length = 443 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QKRRWGSCWS+YWCFGS K +KRIGHA Sbjct: 38 QKRRWGSCWSMYWCFGSQKQTKRIGHA 64 >ref|XP_006413289.1| hypothetical protein EUTSA_v10025027mg [Eutrema salsugineum] gi|557114459|gb|ESQ54742.1| hypothetical protein EUTSA_v10025027mg [Eutrema salsugineum] Length = 489 Score = 59.7 bits (143), Expect = 4e-07 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QK+RWGSCWS+YWCFGS K++KRIGHA Sbjct: 31 QKKRWGSCWSLYWCFGSQKNNKRIGHA 57 >ref|XP_002509822.1| conserved hypothetical protein [Ricinus communis] gi|223549721|gb|EEF51209.1| conserved hypothetical protein [Ricinus communis] Length = 459 Score = 59.7 bits (143), Expect = 4e-07 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QKRRWGSCWS+YWCFG +H KRIGHA Sbjct: 41 QKRRWGSCWSVYWCFGYHRHRKRIGHA 67 >ref|XP_007038765.1| Hydroxyproline-rich glycoprotein family protein isoform 1 [Theobroma cacao] gi|508776010|gb|EOY23266.1| Hydroxyproline-rich glycoprotein family protein isoform 1 [Theobroma cacao] Length = 485 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QK+RWGSCW +YWCFGS K+SKRIGHA Sbjct: 31 QKKRWGSCWGLYWCFGSQKNSKRIGHA 57 >ref|XP_006490432.1| PREDICTED: uncharacterized protein FLJ40925-like [Citrus sinensis] Length = 500 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QKRRWGSCWS+YWCFGS K SKRI HA Sbjct: 31 QKRRWGSCWSLYWCFGSHKTSKRISHA 57 >ref|XP_006343965.1| PREDICTED: uncharacterized protein At1g76660-like [Solanum tuberosum] Length = 443 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QKRRWG CWS+YWCFGS K +KRIGHA Sbjct: 38 QKRRWGGCWSMYWCFGSQKQTKRIGHA 64 >ref|XP_006421977.1| hypothetical protein CICLE_v10004813mg [Citrus clementina] gi|557523850|gb|ESR35217.1| hypothetical protein CICLE_v10004813mg [Citrus clementina] Length = 500 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QKRRWGSCWS+YWCFGS K SKRI HA Sbjct: 31 QKRRWGSCWSLYWCFGSHKTSKRISHA 57 >emb|CBI22685.3| unnamed protein product [Vitis vinifera] Length = 295 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QKRRWGSC S+YWCFGS +HSKRIGHA Sbjct: 31 QKRRWGSCLSLYWCFGSHRHSKRIGHA 57 >ref|XP_002272322.1| PREDICTED: uncharacterized protein LOC100264629 [Vitis vinifera] Length = 448 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QKRRWGSC S+YWCFGS +HSKRIGHA Sbjct: 31 QKRRWGSCLSLYWCFGSHRHSKRIGHA 57 >ref|XP_007038766.1| Hydroxyproline-rich glycoprotein family protein isoform 2 [Theobroma cacao] gi|508776011|gb|EOY23267.1| Hydroxyproline-rich glycoprotein family protein isoform 2 [Theobroma cacao] Length = 489 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -1 Query: 80 KRRWGSCWSIYWCFGSCKHSKRIGHA 3 K+RWGSCW +YWCFGS K+SKRIGHA Sbjct: 36 KKRWGSCWGLYWCFGSQKNSKRIGHA 61 >ref|XP_006476541.1| PREDICTED: uncharacterized protein LOC102626793 [Citrus sinensis] Length = 460 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QKRRWG CWSI WCFG KH KRIGHA Sbjct: 39 QKRRWGGCWSISWCFGFQKHRKRIGHA 65 >ref|XP_004146564.1| PREDICTED: uncharacterized protein LOC101220378 [Cucumis sativus] Length = 464 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QKRRWGSC SIYWCFGS K KRIGHA Sbjct: 42 QKRRWGSCLSIYWCFGSIKQRKRIGHA 68 >ref|XP_007040283.1| Hydroxyproline-rich glycoprotein family protein [Theobroma cacao] gi|508777528|gb|EOY24784.1| Hydroxyproline-rich glycoprotein family protein [Theobroma cacao] Length = 458 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QKRRWG CWSIYWCFGS K KRIG A Sbjct: 38 QKRRWGGCWSIYWCFGSYKQKKRIGPA 64 >ref|XP_006827570.1| hypothetical protein AMTR_s00009p00224560 [Amborella trichopoda] gi|548832190|gb|ERM94986.1| hypothetical protein AMTR_s00009p00224560 [Amborella trichopoda] Length = 501 Score = 55.5 bits (132), Expect = 8e-06 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -1 Query: 83 QKRRWGSCWSIYWCFGSCKHSKRIGHA 3 QKRRWG CWS+YWCFGS +H KRI A Sbjct: 32 QKRRWGGCWSVYWCFGSPRHGKRISRA 58 >ref|XP_004157195.1| PREDICTED: uncharacterized protein LOC101225370 [Cucumis sativus] Length = 497 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 25/30 (83%), Gaps = 2/30 (6%) Frame = -1 Query: 86 PQKRRWGSCWSIYWCF--GSCKHSKRIGHA 3 P KRRWGSCWS+YWCF GS K +KRIGHA Sbjct: 30 PPKRRWGSCWSLYWCFGIGSQKSNKRIGHA 59 >ref|XP_004140832.1| PREDICTED: uncharacterized protein LOC101210841 [Cucumis sativus] Length = 497 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 25/30 (83%), Gaps = 2/30 (6%) Frame = -1 Query: 86 PQKRRWGSCWSIYWCF--GSCKHSKRIGHA 3 P KRRWGSCWS+YWCF GS K +KRIGHA Sbjct: 30 PPKRRWGSCWSLYWCFGIGSQKSNKRIGHA 59