BLASTX nr result
ID: Mentha29_contig00023655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00023655 (451 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018248.1| Uncharacterized protein TCM_034524 [Theobrom... 57 3e-06 >ref|XP_007018248.1| Uncharacterized protein TCM_034524 [Theobroma cacao] gi|508723576|gb|EOY15473.1| Uncharacterized protein TCM_034524 [Theobroma cacao] Length = 115 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 209 ETFLGTRFAE---TVRRSVNEGPITLGVKFLNFCIAKSTQFRYVDPLQAQPSVTKLVFW 376 E++LG F E TV RS+ +G +TL VKFL+F I+K QFRY+ L PS L+FW Sbjct: 42 ESYLGQHFDELGGTVARSIQDGFVTLAVKFLHFFISKCLQFRYLPALLLAPSAMSLLFW 100