BLASTX nr result
ID: Mentha29_contig00023545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00023545 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR92333.1| putative ethylene-responsive element binding prot... 59 5e-07 >gb|ABR92333.1| putative ethylene-responsive element binding protein [Salvia miltiorrhiza] Length = 232 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/49 (59%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = -3 Query: 338 SLESFLGLEPA-QTMSFDSAQFGFDEPVGSFDMWLMDEFGAVQQNDVLF 195 SLESFLGLEP + + + A+FG DEPVGS D+WLMDEF ++ QN+ +F Sbjct: 183 SLESFLGLEPTREPQTPELARFGLDEPVGSVDLWLMDEFVSLGQNNSVF 231