BLASTX nr result
ID: Mentha29_contig00023324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00023324 (836 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007027197.1| Sensory transduction histidine kinase, putat... 100 9e-19 ref|XP_004142221.1| PREDICTED: two-component response regulator-... 98 3e-18 ref|XP_004302833.1| PREDICTED: two-component response regulator-... 98 4e-18 ref|XP_004169415.1| PREDICTED: two-component response regulator-... 97 6e-18 gb|EPS71694.1| hypothetical protein M569_03065, partial [Genlise... 97 1e-17 gb|EXB84826.1| Two-component response regulator-like protein [Mo... 95 4e-17 ref|XP_002525199.1| sensory transduction histidine kinase, putat... 94 6e-17 gb|EYU41647.1| hypothetical protein MIMGU_mgv1a002467mg [Mimulus... 93 1e-16 gb|EYU41646.1| hypothetical protein MIMGU_mgv1a002467mg [Mimulus... 93 1e-16 ref|XP_006594103.1| PREDICTED: two-component response regulator-... 93 1e-16 ref|XP_004249579.1| PREDICTED: two-component response regulator-... 93 1e-16 ref|XP_006594104.1| PREDICTED: two-component response regulator-... 93 1e-16 ref|XP_007009674.1| Pseudo response regulator isoform 11 [Theobr... 93 1e-16 ref|XP_007009672.1| Pseudo response regulator, putative isoform ... 93 1e-16 ref|XP_007009671.1| Pseudo response regulator, putative isoform ... 93 1e-16 ref|XP_007009670.1| Pseudo response regulator, putative isoform ... 93 1e-16 ref|XP_007009668.1| Pseudo response regulator, putative isoform ... 93 1e-16 ref|XP_007009667.1| Pseudo response regulator, putative isoform ... 93 1e-16 ref|XP_007009666.1| Pseudo response regulator isoform 3 [Theobro... 93 1e-16 ref|XP_007009665.1| Pseudo response regulator, putative isoform ... 93 1e-16 >ref|XP_007027197.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|590630175|ref|XP_007027198.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|590630179|ref|XP_007027199.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|508715802|gb|EOY07699.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|508715803|gb|EOY07700.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|508715804|gb|EOY07701.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] Length = 783 Score = 100 bits (248), Expect = 9e-19 Identities = 47/55 (85%), Positives = 54/55 (98%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV++AANGLQA K+LEDLTNHID+VLTEVVMPCLSG+GLLSKIMSHKT+KN+PVI Sbjct: 113 EVIEAANGLQAWKILEDLTNHIDLVLTEVVMPCLSGVGLLSKIMSHKTQKNVPVI 167 >ref|XP_004142221.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Length = 797 Score = 98.2 bits (243), Expect = 3e-18 Identities = 49/60 (81%), Positives = 53/60 (88%) Frame = +2 Query: 656 C*LADEVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 C + EV+ AANGL A KMLEDLTNHID+VLTEVVMPCLSGIGLL KIM+HKTRKNIPVI Sbjct: 109 CNCSYEVIAAANGLHAWKMLEDLTNHIDLVLTEVVMPCLSGIGLLCKIMNHKTRKNIPVI 168 >ref|XP_004302833.1| PREDICTED: two-component response regulator-like APRR7-like [Fragaria vesca subsp. vesca] Length = 732 Score = 97.8 bits (242), Expect = 4e-18 Identities = 44/55 (80%), Positives = 54/55 (98%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV++AANG+QA K+LEDLTNH+D++LTEVVMPC+SGIGLLSKIMSHK+RKN+PVI Sbjct: 102 EVIEAANGIQAWKVLEDLTNHVDLILTEVVMPCVSGIGLLSKIMSHKSRKNVPVI 156 >ref|XP_004169415.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Length = 794 Score = 97.4 bits (241), Expect = 6e-18 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV+ AANGL A KMLEDLTNHID+VLTEVVMPCLSGIGLL KIM+HKTRKNIPVI Sbjct: 114 EVIAAANGLHAWKMLEDLTNHIDLVLTEVVMPCLSGIGLLCKIMNHKTRKNIPVI 168 >gb|EPS71694.1| hypothetical protein M569_03065, partial [Genlisea aurea] Length = 215 Score = 96.7 bits (239), Expect = 1e-17 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EVLDAANG QA K+LEDLTNH+DIVLTEVVMP SG+GLL+KIMSHKTRKNIPVI Sbjct: 75 EVLDAANGFQAWKILEDLTNHVDIVLTEVVMPLFSGVGLLNKIMSHKTRKNIPVI 129 >gb|EXB84826.1| Two-component response regulator-like protein [Morus notabilis] Length = 779 Score = 94.7 bits (234), Expect = 4e-17 Identities = 44/55 (80%), Positives = 51/55 (92%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV++A NGLQA K+LEDLTNH+D++LTEVVMPCLSGI LL KIMSHKTRKN+PVI Sbjct: 115 EVIEATNGLQAWKILEDLTNHVDLILTEVVMPCLSGIALLWKIMSHKTRKNVPVI 169 >ref|XP_002525199.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223535496|gb|EEF37165.1| sensory transduction histidine kinase, putative [Ricinus communis] Length = 762 Score = 94.0 bits (232), Expect = 6e-17 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV++A NGLQA ++LEDLTN ID+VLTEVVMPCLSGIGLL KIMSHKTRKN+PVI Sbjct: 113 EVIEATNGLQAWRILEDLTNQIDLVLTEVVMPCLSGIGLLYKIMSHKTRKNVPVI 167 >gb|EYU41647.1| hypothetical protein MIMGU_mgv1a002467mg [Mimulus guttatus] Length = 658 Score = 93.2 bits (230), Expect = 1e-16 Identities = 48/55 (87%), Positives = 49/55 (89%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EVLDAANGLQA K+LEDLTNHIDIVLTEVVMP LSGIGLLSKI SH R NIPVI Sbjct: 91 EVLDAANGLQAWKILEDLTNHIDIVLTEVVMPSLSGIGLLSKITSHTARNNIPVI 145 >gb|EYU41646.1| hypothetical protein MIMGU_mgv1a002467mg [Mimulus guttatus] Length = 670 Score = 93.2 bits (230), Expect = 1e-16 Identities = 48/55 (87%), Positives = 49/55 (89%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EVLDAANGLQA K+LEDLTNHIDIVLTEVVMP LSGIGLLSKI SH R NIPVI Sbjct: 91 EVLDAANGLQAWKILEDLTNHIDIVLTEVVMPSLSGIGLLSKITSHTARNNIPVI 145 >ref|XP_006594103.1| PREDICTED: two-component response regulator-like APRR7-like isoform X1 [Glycine max] Length = 755 Score = 93.2 bits (230), Expect = 1e-16 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV+DAANGLQA K+LEDLTNHID++LTEV MP LSGIGLL KIM HKTRKNIPV+ Sbjct: 112 EVIDAANGLQAWKILEDLTNHIDLILTEVAMPGLSGIGLLYKIMGHKTRKNIPVV 166 >ref|XP_004249579.1| PREDICTED: two-component response regulator-like PRR73-like [Solanum lycopersicum] Length = 730 Score = 93.2 bits (230), Expect = 1e-16 Identities = 44/55 (80%), Positives = 52/55 (94%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV++AANGLQA K+LE+LTNHID+VLTEVVMPCLSG+GLL+KIMSH TRK +PVI Sbjct: 115 EVIEAANGLQAWKILENLTNHIDLVLTEVVMPCLSGLGLLTKIMSHYTRKTVPVI 169 >ref|XP_006594104.1| PREDICTED: two-component response regulator-like APRR7-like isoform X2 [Glycine max] Length = 749 Score = 93.2 bits (230), Expect = 1e-16 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV+DAANGLQA K+LEDLTNHID++LTEV MP LSGIGLL KIM HKTRKNIPV+ Sbjct: 106 EVIDAANGLQAWKILEDLTNHIDLILTEVAMPGLSGIGLLYKIMGHKTRKNIPVV 160 >ref|XP_007009674.1| Pseudo response regulator isoform 11 [Theobroma cacao] gi|508726587|gb|EOY18484.1| Pseudo response regulator isoform 11 [Theobroma cacao] Length = 579 Score = 92.8 bits (229), Expect = 1e-16 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV +NGLQA K+LEDLTNHID+VLTEVVMPCLSGIGLL KIMSHKTR NIPVI Sbjct: 122 EVTAVSNGLQAWKILEDLTNHIDLVLTEVVMPCLSGIGLLCKIMSHKTRMNIPVI 176 >ref|XP_007009672.1| Pseudo response regulator, putative isoform 9, partial [Theobroma cacao] gi|508726585|gb|EOY18482.1| Pseudo response regulator, putative isoform 9, partial [Theobroma cacao] Length = 769 Score = 92.8 bits (229), Expect = 1e-16 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV +NGLQA K+LEDLTNHID+VLTEVVMPCLSGIGLL KIMSHKTR NIPVI Sbjct: 106 EVTAVSNGLQAWKILEDLTNHIDLVLTEVVMPCLSGIGLLCKIMSHKTRMNIPVI 160 >ref|XP_007009671.1| Pseudo response regulator, putative isoform 8, partial [Theobroma cacao] gi|508726584|gb|EOY18481.1| Pseudo response regulator, putative isoform 8, partial [Theobroma cacao] Length = 708 Score = 92.8 bits (229), Expect = 1e-16 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV +NGLQA K+LEDLTNHID+VLTEVVMPCLSGIGLL KIMSHKTR NIPVI Sbjct: 106 EVTAVSNGLQAWKILEDLTNHIDLVLTEVVMPCLSGIGLLCKIMSHKTRMNIPVI 160 >ref|XP_007009670.1| Pseudo response regulator, putative isoform 7, partial [Theobroma cacao] gi|508726583|gb|EOY18480.1| Pseudo response regulator, putative isoform 7, partial [Theobroma cacao] Length = 709 Score = 92.8 bits (229), Expect = 1e-16 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV +NGLQA K+LEDLTNHID+VLTEVVMPCLSGIGLL KIMSHKTR NIPVI Sbjct: 106 EVTAVSNGLQAWKILEDLTNHIDLVLTEVVMPCLSGIGLLCKIMSHKTRMNIPVI 160 >ref|XP_007009668.1| Pseudo response regulator, putative isoform 5 [Theobroma cacao] gi|508726581|gb|EOY18478.1| Pseudo response regulator, putative isoform 5 [Theobroma cacao] Length = 781 Score = 92.8 bits (229), Expect = 1e-16 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV +NGLQA K+LEDLTNHID+VLTEVVMPCLSGIGLL KIMSHKTR NIPVI Sbjct: 122 EVTAVSNGLQAWKILEDLTNHIDLVLTEVVMPCLSGIGLLCKIMSHKTRMNIPVI 176 >ref|XP_007009667.1| Pseudo response regulator, putative isoform 4 [Theobroma cacao] gi|508726580|gb|EOY18477.1| Pseudo response regulator, putative isoform 4 [Theobroma cacao] Length = 732 Score = 92.8 bits (229), Expect = 1e-16 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV +NGLQA K+LEDLTNHID+VLTEVVMPCLSGIGLL KIMSHKTR NIPVI Sbjct: 122 EVTAVSNGLQAWKILEDLTNHIDLVLTEVVMPCLSGIGLLCKIMSHKTRMNIPVI 176 >ref|XP_007009666.1| Pseudo response regulator isoform 3 [Theobroma cacao] gi|590564476|ref|XP_007009669.1| Pseudo response regulator isoform 3 [Theobroma cacao] gi|508726579|gb|EOY18476.1| Pseudo response regulator isoform 3 [Theobroma cacao] gi|508726582|gb|EOY18479.1| Pseudo response regulator isoform 3 [Theobroma cacao] Length = 792 Score = 92.8 bits (229), Expect = 1e-16 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV +NGLQA K+LEDLTNHID+VLTEVVMPCLSGIGLL KIMSHKTR NIPVI Sbjct: 122 EVTAVSNGLQAWKILEDLTNHIDLVLTEVVMPCLSGIGLLCKIMSHKTRMNIPVI 176 >ref|XP_007009665.1| Pseudo response regulator, putative isoform 2 [Theobroma cacao] gi|508726578|gb|EOY18475.1| Pseudo response regulator, putative isoform 2 [Theobroma cacao] Length = 782 Score = 92.8 bits (229), Expect = 1e-16 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +2 Query: 671 EVLDAANGLQACKMLEDLTNHIDIVLTEVVMPCLSGIGLLSKIMSHKTRKNIPVI 835 EV +NGLQA K+LEDLTNHID+VLTEVVMPCLSGIGLL KIMSHKTR NIPVI Sbjct: 122 EVTAVSNGLQAWKILEDLTNHIDLVLTEVVMPCLSGIGLLCKIMSHKTRMNIPVI 176