BLASTX nr result
ID: Mentha29_contig00022907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00022907 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC23014.1| hypothetical protein L484_001209 [Morus notabilis] 59 9e-07 gb|EYU22942.1| hypothetical protein MIMGU_mgv1a002835mg [Mimulus... 55 1e-05 >gb|EXC23014.1| hypothetical protein L484_001209 [Morus notabilis] Length = 657 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +1 Query: 82 LNLFDGNGDSSDEDPSKIEIDHEFANRYNHNKERDELQQYN 204 +NLFDG+ DS +ED SKIEID EFA RY HNK+R++LQ+Y+ Sbjct: 3 INLFDGS-DSDNEDVSKIEIDKEFARRYEHNKKREDLQRYD 42 >gb|EYU22942.1| hypothetical protein MIMGU_mgv1a002835mg [Mimulus guttatus] Length = 633 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/46 (58%), Positives = 34/46 (73%), Gaps = 3/46 (6%) Frame = +1 Query: 73 MDRLNLFDGNGDS---SDEDPSKIEIDHEFANRYNHNKERDELQQY 201 M RL LFD DS ++D SKIEI+HEFA RY +NK+R+ELQ+Y Sbjct: 1 MGRLQLFDDGDDSPNGGEDDLSKIEINHEFAKRYEYNKKREELQKY 46