BLASTX nr result
ID: Mentha29_contig00022775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00022775 (594 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003629838.1| 39S ribosomal protein L46 [Medicago truncatu... 42 7e-09 ref|XP_007218304.1| hypothetical protein PRUPE_ppa010842mg [Prun... 44 1e-06 ref|XP_006444943.1| hypothetical protein CICLE_v10021940mg [Citr... 40 4e-06 ref|XP_006444940.1| hypothetical protein CICLE_v10021940mg [Citr... 40 4e-06 ref|XP_006444944.1| hypothetical protein CICLE_v10021940mg [Citr... 40 4e-06 ref|XP_006444942.1| hypothetical protein CICLE_v10021940mg [Citr... 40 4e-06 ref|XP_004307545.1| PREDICTED: 39S ribosomal protein L46, mitoch... 38 6e-06 >ref|XP_003629838.1| 39S ribosomal protein L46 [Medicago truncatula] gi|355523860|gb|AET04314.1| 39S ribosomal protein L46 [Medicago truncatula] Length = 279 Score = 42.0 bits (97), Expect(3) = 7e-09 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -2 Query: 251 LARPLLMAARGFGTSSGGSEKIVAPVLFERLPVVI 147 L RPLLM RGF TSS EK+VA VLFERLPVVI Sbjct: 56 LVRPLLMR-RGFSTSS---EKMVASVLFERLPVVI 86 Score = 33.9 bits (76), Expect(3) = 7e-09 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -3 Query: 142 FQEFSFRWQREYRREYLESLLPK 74 FQEFSFRW+++Y+R Y + L + Sbjct: 96 FQEFSFRWRQQYQRRYPDEFLDR 118 Score = 29.6 bits (65), Expect(3) = 7e-09 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -2 Query: 89 IVTAKKNLKERSL*RALDQRLYLLVTG 9 I A K RSL RALD+RLYLL+ G Sbjct: 137 ITEADKQNDRRSLQRALDRRLYLLLFG 163 >ref|XP_007218304.1| hypothetical protein PRUPE_ppa010842mg [Prunus persica] gi|462414766|gb|EMJ19503.1| hypothetical protein PRUPE_ppa010842mg [Prunus persica] Length = 233 Score = 43.9 bits (102), Expect(2) = 1e-06 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -2 Query: 251 LARPLLMAARGFGTSSGGSEKIVAPVLFERLPVVI 147 + R L+ RGF TSS S+KIVA VLFERLPVVI Sbjct: 7 ILRGPLVRDRGFSTSSSSSQKIVASVLFERLPVVI 41 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -3 Query: 142 FQEFSFRWQREYRREYLESLLPK 74 +QEF+FRW+++YRR Y + LL K Sbjct: 51 YQEFAFRWRQQYRRIYPDELLDK 73 >ref|XP_006444943.1| hypothetical protein CICLE_v10021940mg [Citrus clementina] gi|568876239|ref|XP_006491192.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform X1 [Citrus sinensis] gi|557547205|gb|ESR58183.1| hypothetical protein CICLE_v10021940mg [Citrus clementina] Length = 241 Score = 40.0 bits (92), Expect(2) = 4e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -2 Query: 251 LARPLLMAARGFGTSSGGSEKIVAPVLFERLPVVI 147 L RPL A RGF T+S EKIVA VLFERLPVVI Sbjct: 18 LVRPLT-ATRGFSTNS---EKIVASVLFERLPVVI 48 Score = 36.6 bits (83), Expect(2) = 4e-06 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -3 Query: 142 FQEFSFRWQREYRREYLESLLPK 74 FQEFSFRW+++YRR Y + L K Sbjct: 58 FQEFSFRWRQQYRRRYPDEFLDK 80 >ref|XP_006444940.1| hypothetical protein CICLE_v10021940mg [Citrus clementina] gi|567904906|ref|XP_006444941.1| hypothetical protein CICLE_v10021940mg [Citrus clementina] gi|567904914|ref|XP_006444945.1| hypothetical protein CICLE_v10021940mg [Citrus clementina] gi|568876241|ref|XP_006491193.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform X2 [Citrus sinensis] gi|568876243|ref|XP_006491194.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform X3 [Citrus sinensis] gi|568876245|ref|XP_006491195.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform X4 [Citrus sinensis] gi|557547202|gb|ESR58180.1| hypothetical protein CICLE_v10021940mg [Citrus clementina] gi|557547203|gb|ESR58181.1| hypothetical protein CICLE_v10021940mg [Citrus clementina] gi|557547207|gb|ESR58185.1| hypothetical protein CICLE_v10021940mg [Citrus clementina] Length = 231 Score = 40.0 bits (92), Expect(2) = 4e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -2 Query: 251 LARPLLMAARGFGTSSGGSEKIVAPVLFERLPVVI 147 L RPL A RGF T+S EKIVA VLFERLPVVI Sbjct: 8 LVRPLT-ATRGFSTNS---EKIVASVLFERLPVVI 38 Score = 36.6 bits (83), Expect(2) = 4e-06 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -3 Query: 142 FQEFSFRWQREYRREYLESLLPK 74 FQEFSFRW+++YRR Y + L K Sbjct: 48 FQEFSFRWRQQYRRRYPDEFLDK 70 >ref|XP_006444944.1| hypothetical protein CICLE_v10021940mg [Citrus clementina] gi|557547206|gb|ESR58184.1| hypothetical protein CICLE_v10021940mg [Citrus clementina] Length = 177 Score = 40.0 bits (92), Expect(2) = 4e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -2 Query: 251 LARPLLMAARGFGTSSGGSEKIVAPVLFERLPVVI 147 L RPL A RGF T+S EKIVA VLFERLPVVI Sbjct: 18 LVRPLT-ATRGFSTNS---EKIVASVLFERLPVVI 48 Score = 36.6 bits (83), Expect(2) = 4e-06 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -3 Query: 142 FQEFSFRWQREYRREYLESLLPK 74 FQEFSFRW+++YRR Y + L K Sbjct: 58 FQEFSFRWRQQYRRRYPDEFLDK 80 >ref|XP_006444942.1| hypothetical protein CICLE_v10021940mg [Citrus clementina] gi|557547204|gb|ESR58182.1| hypothetical protein CICLE_v10021940mg [Citrus clementina] Length = 167 Score = 40.0 bits (92), Expect(2) = 4e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -2 Query: 251 LARPLLMAARGFGTSSGGSEKIVAPVLFERLPVVI 147 L RPL A RGF T+S EKIVA VLFERLPVVI Sbjct: 8 LVRPLT-ATRGFSTNS---EKIVASVLFERLPVVI 38 Score = 36.6 bits (83), Expect(2) = 4e-06 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -3 Query: 142 FQEFSFRWQREYRREYLESLLPK 74 FQEFSFRW+++YRR Y + L K Sbjct: 48 FQEFSFRWRQQYRRRYPDEFLDK 70 >ref|XP_004307545.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 231 Score = 38.1 bits (87), Expect(2) = 6e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 224 RGFGTSSGGSEKIVAPVLFERLPVVI 147 RGF T+S SEKIVA VLFERLPVVI Sbjct: 14 RGFNTTSS-SEKIVASVLFERLPVVI 38 Score = 38.1 bits (87), Expect(2) = 6e-06 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -3 Query: 142 FQEFSFRWQREYRREYLESLLPK 74 FQEFSFRW+++YRR Y + LL K Sbjct: 48 FQEFSFRWRQQYRRRYPDELLDK 70