BLASTX nr result
ID: Mentha29_contig00022529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00022529 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41811.1| hypothetical protein MIMGU_mgv1a012888mg [Mimulus... 72 1e-10 ref|XP_006363094.1| PREDICTED: uncharacterized protein LOC102591... 72 1e-10 ref|XP_006349479.1| PREDICTED: uncharacterized protein LOC102591... 72 1e-10 ref|XP_004249673.1| PREDICTED: uncharacterized protein LOC101251... 72 1e-10 ref|XP_004246369.1| PREDICTED: uncharacterized protein LOC101262... 72 1e-10 gb|EPS63776.1| hypothetical protein M569_11008, partial [Genlise... 69 5e-10 gb|EYU26631.1| hypothetical protein MIMGU_mgv1a015086mg [Mimulus... 65 1e-08 ref|XP_006582935.1| PREDICTED: uncharacterized protein LOC100808... 64 2e-08 ref|XP_007140442.1| hypothetical protein PHAVU_008G112400g [Phas... 64 2e-08 ref|XP_006453532.1| hypothetical protein CICLE_v10009581mg [Citr... 64 2e-08 ref|XP_004492389.1| PREDICTED: uncharacterized protein LOC101493... 64 2e-08 ref|XP_004302680.1| PREDICTED: uncharacterized protein LOC101299... 64 2e-08 ref|XP_007205872.1| hypothetical protein PRUPE_ppa011216mg [Prun... 64 2e-08 emb|CBI30457.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|NP_001241435.1| uncharacterized protein LOC100808666 [Glycin... 64 2e-08 ref|XP_002273450.1| PREDICTED: uncharacterized protein LOC100252... 64 2e-08 ref|XP_002527891.1| protein binding protein, putative [Ricinus c... 64 2e-08 gb|EYU30478.1| hypothetical protein MIMGU_mgv1a013211mg [Mimulus... 64 2e-08 gb|EXC07550.1| hypothetical protein L484_005857 [Morus notabilis] 64 2e-08 ref|XP_007141812.1| hypothetical protein PHAVU_008G227700g [Phas... 64 2e-08 >gb|EYU41811.1| hypothetical protein MIMGU_mgv1a012888mg [Mimulus guttatus] Length = 237 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 64 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS 156 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS Sbjct: 207 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS 237 >ref|XP_006363094.1| PREDICTED: uncharacterized protein LOC102591310 [Solanum tuberosum] Length = 231 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 64 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS 156 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS Sbjct: 201 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS 231 >ref|XP_006349479.1| PREDICTED: uncharacterized protein LOC102591798 [Solanum tuberosum] Length = 206 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 64 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS 156 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS Sbjct: 176 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS 206 >ref|XP_004249673.1| PREDICTED: uncharacterized protein LOC101251531 [Solanum lycopersicum] Length = 203 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 64 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS 156 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS Sbjct: 173 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS 203 >ref|XP_004246369.1| PREDICTED: uncharacterized protein LOC101262037 [Solanum lycopersicum] Length = 233 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 64 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS 156 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS Sbjct: 203 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS 233 >gb|EPS63776.1| hypothetical protein M569_11008, partial [Genlisea aurea] Length = 158 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +1 Query: 64 CLNGHRFLNFLLACMVFAFVISWLFHFNIPS 156 CL+GHRFLNFLLACMVFAFVISWLFHFN+PS Sbjct: 128 CLSGHRFLNFLLACMVFAFVISWLFHFNVPS 158 >gb|EYU26631.1| hypothetical protein MIMGU_mgv1a015086mg [Mimulus guttatus] Length = 168 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 67 LNGHRFLNFLLACMVFAFVISWLFHFNIPS 156 LNGHRFLNF+LAC VFAFVISWLFHFN+PS Sbjct: 139 LNGHRFLNFILACFVFAFVISWLFHFNLPS 168 >ref|XP_006582935.1| PREDICTED: uncharacterized protein LOC100808666 isoform X1 [Glycine max] gi|571464072|ref|XP_006582936.1| PREDICTED: uncharacterized protein LOC100808666 isoform X2 [Glycine max] gi|571464074|ref|XP_006582937.1| PREDICTED: uncharacterized protein LOC100808666 isoform X3 [Glycine max] Length = 227 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 70 NGHRFLNFLLACMVFAFVISWLFHFNIPS 156 +GHRFLNFLLACMVFAFVISWLFHFN+PS Sbjct: 198 HGHRFLNFLLACMVFAFVISWLFHFNVPS 226 >ref|XP_007140442.1| hypothetical protein PHAVU_008G112400g [Phaseolus vulgaris] gi|561013575|gb|ESW12436.1| hypothetical protein PHAVU_008G112400g [Phaseolus vulgaris] Length = 230 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 70 NGHRFLNFLLACMVFAFVISWLFHFNIPS 156 +GHRFLNFLLACMVFAFVISWLFHFN+PS Sbjct: 201 HGHRFLNFLLACMVFAFVISWLFHFNVPS 229 >ref|XP_006453532.1| hypothetical protein CICLE_v10009581mg [Citrus clementina] gi|568840216|ref|XP_006474066.1| PREDICTED: uncharacterized protein LOC102626292 [Citrus sinensis] gi|557556758|gb|ESR66772.1| hypothetical protein CICLE_v10009581mg [Citrus clementina] Length = 193 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 73 GHRFLNFLLACMVFAFVISWLFHFNIPS 156 GHRFLNFLLACMVFAFVISWLFHFNIPS Sbjct: 166 GHRFLNFLLACMVFAFVISWLFHFNIPS 193 >ref|XP_004492389.1| PREDICTED: uncharacterized protein LOC101493065 [Cicer arietinum] Length = 234 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 70 NGHRFLNFLLACMVFAFVISWLFHFNIPS 156 +GHRFLNFLLACMVFAFVISWLFHFN+PS Sbjct: 205 HGHRFLNFLLACMVFAFVISWLFHFNVPS 233 >ref|XP_004302680.1| PREDICTED: uncharacterized protein LOC101299878 [Fragaria vesca subsp. vesca] Length = 241 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 70 NGHRFLNFLLACMVFAFVISWLFHFNIPS 156 +GHRFLNFLLACMVFAFVISWLFHFN+PS Sbjct: 213 HGHRFLNFLLACMVFAFVISWLFHFNVPS 241 >ref|XP_007205872.1| hypothetical protein PRUPE_ppa011216mg [Prunus persica] gi|462401514|gb|EMJ07071.1| hypothetical protein PRUPE_ppa011216mg [Prunus persica] Length = 219 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 70 NGHRFLNFLLACMVFAFVISWLFHFNIPS 156 +GHRFLNFLLACMVFAFVISWLFHFN+PS Sbjct: 191 HGHRFLNFLLACMVFAFVISWLFHFNVPS 219 >emb|CBI30457.3| unnamed protein product [Vitis vinifera] Length = 161 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 70 NGHRFLNFLLACMVFAFVISWLFHFNIPS 156 +GHRFLNFLLACMVFAFVISWLFHFN+PS Sbjct: 133 HGHRFLNFLLACMVFAFVISWLFHFNVPS 161 >ref|NP_001241435.1| uncharacterized protein LOC100808666 [Glycine max] gi|255648218|gb|ACU24562.1| unknown [Glycine max] Length = 232 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 70 NGHRFLNFLLACMVFAFVISWLFHFNIPS 156 +GHRFLNFLLACMVFAFVISWLFHFN+PS Sbjct: 203 HGHRFLNFLLACMVFAFVISWLFHFNVPS 231 >ref|XP_002273450.1| PREDICTED: uncharacterized protein LOC100252869 [Vitis vinifera] Length = 236 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 70 NGHRFLNFLLACMVFAFVISWLFHFNIPS 156 +GHRFLNFLLACMVFAFVISWLFHFN+PS Sbjct: 208 HGHRFLNFLLACMVFAFVISWLFHFNVPS 236 >ref|XP_002527891.1| protein binding protein, putative [Ricinus communis] gi|223532742|gb|EEF34522.1| protein binding protein, putative [Ricinus communis] Length = 218 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 70 NGHRFLNFLLACMVFAFVISWLFHFNIPS 156 +GHRFLNFLLACMVFAFVISWLFHFN+PS Sbjct: 189 HGHRFLNFLLACMVFAFVISWLFHFNVPS 217 >gb|EYU30478.1| hypothetical protein MIMGU_mgv1a013211mg [Mimulus guttatus] Length = 227 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 73 GHRFLNFLLACMVFAFVISWLFHFNIPS 156 GHRFLNFLLACMVFAFVISWLFHFN+PS Sbjct: 200 GHRFLNFLLACMVFAFVISWLFHFNVPS 227 >gb|EXC07550.1| hypothetical protein L484_005857 [Morus notabilis] Length = 208 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 73 GHRFLNFLLACMVFAFVISWLFHFNIPS 156 GHRFLNFLLACMVFAFVISWLFHFN+PS Sbjct: 181 GHRFLNFLLACMVFAFVISWLFHFNVPS 208 >ref|XP_007141812.1| hypothetical protein PHAVU_008G227700g [Phaseolus vulgaris] gi|561014945|gb|ESW13806.1| hypothetical protein PHAVU_008G227700g [Phaseolus vulgaris] Length = 217 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 73 GHRFLNFLLACMVFAFVISWLFHFNIPS 156 GHRFLNFLLACMVFAFVISWLFHFN+PS Sbjct: 190 GHRFLNFLLACMVFAFVISWLFHFNVPS 217