BLASTX nr result
ID: Mentha29_contig00022526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00022526 (215 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44289.1| hypothetical protein MIMGU_mgv1a009190mg [Mimulus... 62 8e-08 >gb|EYU44289.1| hypothetical protein MIMGU_mgv1a009190mg [Mimulus guttatus] Length = 350 Score = 62.0 bits (149), Expect = 8e-08 Identities = 35/72 (48%), Positives = 48/72 (66%), Gaps = 1/72 (1%) Frame = +1 Query: 1 ELDSIEQNLIAELKRARASADHSHAGEPNGMHNESQQ-TVKAQEXXXXXXXXLMEKLDSK 177 E+D IE+NL E +RA++S D + GE + NESQ TV QE LMEKLD+K Sbjct: 140 EMDLIERNLEEEWQRAKSSVDAKNLGESTEVLNESQSSTVGVQEEAEAPKSALMEKLDNK 199 Query: 178 KKDMATIEDIVQ 213 KK++A++E+IVQ Sbjct: 200 KKELASMEEIVQ 211