BLASTX nr result
ID: Mentha29_contig00022510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00022510 (670 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006856965.1| hypothetical protein AMTR_s00832p00002090 [A... 61 4e-07 ref|XP_006830015.1| hypothetical protein AMTR_s04836p00002630, p... 58 3e-06 ref|XP_006848744.1| hypothetical protein AMTR_s04155p00003130 [A... 56 9e-06 >ref|XP_006856965.1| hypothetical protein AMTR_s00832p00002090 [Amborella trichopoda] gi|548861001|gb|ERN18432.1| hypothetical protein AMTR_s00832p00002090 [Amborella trichopoda] Length = 498 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 5/88 (5%) Frame = +2 Query: 71 IAKYLYILEKMNPGSEVDLQTCEDSKFKYCFFSLSASIRAFCAC*PVIVIDATHPMYLRI 250 I +L+++EK NPGS VDL+T ED+ + F +L ASI+ + AC P++V+D T +L+ Sbjct: 80 IPSFLHMVEKTNPGSFVDLKTAEDNSLLFVFMALDASIKGWGACRPIVVVDGT---FLKA 136 Query: 251 AFTSPAIFSYPP-----VSPCAFCPANA 319 A+ + + + P AFC A++ Sbjct: 137 AYGGTLLCACTQDAAGHIFPLAFCVADS 164 >ref|XP_006830015.1| hypothetical protein AMTR_s04836p00002630, partial [Amborella trichopoda] gi|548835784|gb|ERM97431.1| hypothetical protein AMTR_s04836p00002630, partial [Amborella trichopoda] Length = 547 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/54 (51%), Positives = 38/54 (70%) Frame = +2 Query: 68 EIAKYLYILEKMNPGSEVDLQTCEDSKFKYCFFSLSASIRAFCAC*PVIVIDAT 229 ++ Y Y+LE+ NPG+ D+ T ED++FKYCF+SL+A R F C PVI ID T Sbjct: 425 QLPGYFYVLEQKNPGTITDIIT-EDNRFKYCFWSLAACRRGFKFCRPVISIDGT 477 >ref|XP_006848744.1| hypothetical protein AMTR_s04155p00003130 [Amborella trichopoda] gi|548852169|gb|ERN10325.1| hypothetical protein AMTR_s04155p00003130 [Amborella trichopoda] Length = 590 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/50 (56%), Positives = 33/50 (66%) Frame = +2 Query: 80 YLYILEKMNPGSEVDLQTCEDSKFKYCFFSLSASIRAFCAC*PVIVIDAT 229 YLY+LE+ NPG+ DL ED +FKYCF SL A R F C PV+ ID T Sbjct: 169 YLYMLEQKNPGTITDLYL-EDERFKYCFISLGACRRGFSFCRPVLSIDGT 217