BLASTX nr result
ID: Mentha29_contig00022165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00022165 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007153863.1| hypothetical protein PHAVU_003G071100g [Phas... 56 6e-06 >ref|XP_007153863.1| hypothetical protein PHAVU_003G071100g [Phaseolus vulgaris] gi|561027217|gb|ESW25857.1| hypothetical protein PHAVU_003G071100g [Phaseolus vulgaris] Length = 489 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -3 Query: 131 SSPSLFNQSMEQFLNAKIVRLKSCHDKYLTADEDEESVVQGRD 3 SS ++F ME F AK+VRL+S HDKYL ADEDEESV Q R+ Sbjct: 187 SSDTMFRSGMELFHRAKVVRLRSHHDKYLLADEDEESVTQDRN 229