BLASTX nr result
ID: Mentha29_contig00021929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00021929 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45637.1| hypothetical protein MIMGU_mgv1a007414mg [Mimulus... 65 8e-09 gb|EPS64537.1| hypothetical protein M569_10245 [Genlisea aurea] 61 1e-07 ref|XP_006359904.1| PREDICTED: cyclin-T1-4-like isoform X1 [Sola... 60 4e-07 gb|EYU41508.1| hypothetical protein MIMGU_mgv1a013067mg [Mimulus... 57 4e-06 ref|XP_004247372.1| PREDICTED: cyclin-T1-4-like [Solanum lycoper... 57 4e-06 >gb|EYU45637.1| hypothetical protein MIMGU_mgv1a007414mg [Mimulus guttatus] Length = 408 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 382 AKFLNMNLASCHSVWHEFHTPPPVLRDVANQLMEL 278 AKFLNMNL SCH+VW+ FHTPP VLRDVA+QLMEL Sbjct: 373 AKFLNMNLPSCHNVWNGFHTPPSVLRDVAHQLMEL 407 >gb|EPS64537.1| hypothetical protein M569_10245 [Genlisea aurea] Length = 408 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 382 AKFLNMNLASCHSVWHEFHTPPPVLRDVANQLME 281 +KFLNMNLAS H VW+EFHTPP VL+D+A QLME Sbjct: 360 SKFLNMNLASAHMVWNEFHTPPSVLKDIAKQLME 393 >ref|XP_006359904.1| PREDICTED: cyclin-T1-4-like isoform X1 [Solanum tuberosum] Length = 400 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 382 AKFLNMNLASCHSVWHEFHTPPPVLRDVANQLMELF 275 +KFLNM+ AS HSVW EF TPP VLRDVA QLMELF Sbjct: 365 SKFLNMDFASHHSVWKEFQTPPNVLRDVAQQLMELF 400 >gb|EYU41508.1| hypothetical protein MIMGU_mgv1a013067mg [Mimulus guttatus] Length = 231 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 382 AKFLNMNLASCHSVWHEFHTPPPVLRDVANQLMEL 278 AKFLNMNLAS VW EFHT P VL+DVA+QLMEL Sbjct: 196 AKFLNMNLASSDDVWLEFHTTPSVLKDVAHQLMEL 230 >ref|XP_004247372.1| PREDICTED: cyclin-T1-4-like [Solanum lycopersicum] Length = 397 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -3 Query: 382 AKFLNMNLASCHSVWHEFHTPPPVLRDVANQLMELF 275 +KFLNM+ AS HSVW EF T P VLRDVA QLMELF Sbjct: 362 SKFLNMDFASHHSVWKEFQTSPNVLRDVAQQLMELF 397