BLASTX nr result
ID: Mentha29_contig00021927
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00021927 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43283.1| hypothetical protein MIMGU_mgv1a002920mg [Mimulus... 57 3e-06 >gb|EYU43283.1| hypothetical protein MIMGU_mgv1a002920mg [Mimulus guttatus] Length = 625 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 4/50 (8%) Frame = +1 Query: 40 ALPSNLSPANVQPTRETDLQYSQFPLTQSMSAKFGNS----GASAISMSE 177 +LP +L ANVQPTRE+DL YS F TQSMSAK+GN+ G SA+ M E Sbjct: 329 SLPGSLLNANVQPTRESDLHYSPFSATQSMSAKYGNAVSSMGVSALPMPE 378