BLASTX nr result
ID: Mentha29_contig00021858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00021858 (219 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006288806.1| hypothetical protein CARUB_v10002138mg [Caps... 106 3e-21 ref|XP_002871470.1| hypothetical protein ARALYDRAFT_909096 [Arab... 106 3e-21 ref|XP_007013795.1| Acyl-CoA N-acyltransferases (NAT) superfamil... 106 4e-21 ref|XP_007142545.1| hypothetical protein PHAVU_008G289800g [Phas... 105 6e-21 ref|XP_002308640.1| hypothetical protein POPTR_0006s26500g [Popu... 105 6e-21 ref|XP_006399636.1| hypothetical protein EUTSA_v10014874mg [Eutr... 104 1e-20 ref|XP_002514360.1| Pre-mRNA-splicing factor cwc24, putative [Ri... 104 1e-20 ref|XP_006450513.1| hypothetical protein CICLE_v10009736mg [Citr... 103 2e-20 ref|NP_001238648.1| uncharacterized protein LOC100499961 [Glycin... 103 2e-20 gb|EXB94137.1| N-alpha-acetyltransferase 50 [Morus notabilis] 103 2e-20 ref|XP_002284766.1| PREDICTED: N-alpha-acetyltransferase 50 [Vit... 102 5e-20 ref|XP_006353645.1| PREDICTED: N-alpha-acetyltransferase 50-like... 102 7e-20 ref|NP_196695.1| GCN5-related N-acetyltransferase (GNAT) family ... 101 9e-20 ref|XP_004138740.1| PREDICTED: N-alpha-acetyltransferase 50-like... 101 1e-19 ref|XP_003618084.1| N-acetyltransferase NAT13 [Medicago truncatu... 101 1e-19 ref|NP_001235839.1| uncharacterized protein LOC100527165 [Glycin... 101 1e-19 ref|XP_004241808.1| PREDICTED: N-alpha-acetyltransferase 50-like... 100 2e-19 gb|EPS73274.1| hypothetical protein M569_01484 [Genlisea aurea] 100 3e-19 ref|XP_004491672.1| PREDICTED: probable N-acetyltransferase san-... 100 3e-19 ref|XP_004245217.1| PREDICTED: N-alpha-acetyltransferase 50-like... 100 3e-19 >ref|XP_006288806.1| hypothetical protein CARUB_v10002138mg [Capsella rubella] gi|482557512|gb|EOA21704.1| hypothetical protein CARUB_v10002138mg [Capsella rubella] Length = 164 Score = 106 bits (265), Expect = 3e-21 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGRE+++SLD VRDKNLMQLKKLNT LFPVRYNDKYYADAIASGEFTKLAYY DIC Sbjct: 3 AGREVSVSLDGVRDKNLMQLKKLNTVLFPVRYNDKYYADAIASGEFTKLAYYSDIC 58 >ref|XP_002871470.1| hypothetical protein ARALYDRAFT_909096 [Arabidopsis lyrata subsp. lyrata] gi|297317307|gb|EFH47729.1| hypothetical protein ARALYDRAFT_909096 [Arabidopsis lyrata subsp. lyrata] Length = 164 Score = 106 bits (265), Expect = 3e-21 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGRE+++SLD VRDKNLMQLKKLNT LFPVRYNDKYYADAIASGEFTKLAYY DIC Sbjct: 3 AGREVSVSLDGVRDKNLMQLKKLNTVLFPVRYNDKYYADAIASGEFTKLAYYSDIC 58 >ref|XP_007013795.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein [Theobroma cacao] gi|508784158|gb|EOY31414.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein [Theobroma cacao] Length = 164 Score = 106 bits (264), Expect = 4e-21 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGRE+ ISLD VRDKN+MQLKKLNTALFPVRYNDKYYADA+ASGEFTKLAYY DIC Sbjct: 3 AGREVAISLDGVRDKNVMQLKKLNTALFPVRYNDKYYADALASGEFTKLAYYSDIC 58 >ref|XP_007142545.1| hypothetical protein PHAVU_008G289800g [Phaseolus vulgaris] gi|561015678|gb|ESW14539.1| hypothetical protein PHAVU_008G289800g [Phaseolus vulgaris] Length = 165 Score = 105 bits (262), Expect = 6e-21 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGRE++ISLD VRDKNLMQLKKLN ALFPVRYNDKYYADA+ASGEFTKLAYY DIC Sbjct: 3 AGREVSISLDGVRDKNLMQLKKLNLALFPVRYNDKYYADALASGEFTKLAYYSDIC 58 >ref|XP_002308640.1| hypothetical protein POPTR_0006s26500g [Populus trichocarpa] gi|222854616|gb|EEE92163.1| hypothetical protein POPTR_0006s26500g [Populus trichocarpa] Length = 162 Score = 105 bits (262), Expect = 6e-21 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGRE++ISLD VRDKN+MQLKKLNTALFPVRYNDKYYADA+ASG+FTKLAYY DIC Sbjct: 3 AGREVSISLDGVRDKNVMQLKKLNTALFPVRYNDKYYADALASGDFTKLAYYSDIC 58 >ref|XP_006399636.1| hypothetical protein EUTSA_v10014874mg [Eutrema salsugineum] gi|557100726|gb|ESQ41089.1| hypothetical protein EUTSA_v10014874mg [Eutrema salsugineum] Length = 164 Score = 104 bits (260), Expect = 1e-20 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = +3 Query: 54 GRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 GRE++ISLD VRDKN+MQLKKLNT LFPVRYNDKYYADAIASGEFTKLAYY DIC Sbjct: 4 GREVSISLDGVRDKNMMQLKKLNTVLFPVRYNDKYYADAIASGEFTKLAYYSDIC 58 >ref|XP_002514360.1| Pre-mRNA-splicing factor cwc24, putative [Ricinus communis] gi|223546816|gb|EEF48314.1| Pre-mRNA-splicing factor cwc24, putative [Ricinus communis] Length = 163 Score = 104 bits (260), Expect = 1e-20 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGRE++ISLD VRDKN+MQLKKLNTALFPVRYNDKYY+DA+ASG+FTKLAYY DIC Sbjct: 3 AGREMSISLDGVRDKNVMQLKKLNTALFPVRYNDKYYSDALASGDFTKLAYYSDIC 58 >ref|XP_006450513.1| hypothetical protein CICLE_v10009736mg [Citrus clementina] gi|568859551|ref|XP_006483302.1| PREDICTED: N-alpha-acetyltransferase 50-like [Citrus sinensis] gi|557553739|gb|ESR63753.1| hypothetical protein CICLE_v10009736mg [Citrus clementina] Length = 164 Score = 103 bits (258), Expect = 2e-20 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGRE+ ISLD VRDKNLMQLKKLN ALFPVRYNDKYY+DA+ASGEFTKLAYY DIC Sbjct: 3 AGREVAISLDGVRDKNLMQLKKLNIALFPVRYNDKYYSDALASGEFTKLAYYSDIC 58 >ref|NP_001238648.1| uncharacterized protein LOC100499961 [Glycine max] gi|255628029|gb|ACU14359.1| unknown [Glycine max] Length = 165 Score = 103 bits (258), Expect = 2e-20 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGRE++ISLD VRDKNLMQLKKLN ALFPVRYNDKYY DA+ASGEFTKLAYY DIC Sbjct: 3 AGREVSISLDGVRDKNLMQLKKLNLALFPVRYNDKYYTDALASGEFTKLAYYSDIC 58 >gb|EXB94137.1| N-alpha-acetyltransferase 50 [Morus notabilis] Length = 164 Score = 103 bits (257), Expect = 2e-20 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGRE+ ISLD VRDKNLMQLKKLNTALFPVRYNDKYYADA+AS +FTKLAYY DIC Sbjct: 3 AGREVQISLDGVRDKNLMQLKKLNTALFPVRYNDKYYADALASADFTKLAYYSDIC 58 >ref|XP_002284766.1| PREDICTED: N-alpha-acetyltransferase 50 [Vitis vinifera] gi|147776900|emb|CAN65722.1| hypothetical protein VITISV_004445 [Vitis vinifera] gi|296081968|emb|CBI20973.3| unnamed protein product [Vitis vinifera] Length = 164 Score = 102 bits (254), Expect = 5e-20 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGR ++ISLD VRDKN+MQLKKLNTALFPVRYN+KYYADA+ASGEFTKLAYY DIC Sbjct: 3 AGRGVSISLDGVRDKNVMQLKKLNTALFPVRYNEKYYADALASGEFTKLAYYSDIC 58 >ref|XP_006353645.1| PREDICTED: N-alpha-acetyltransferase 50-like [Solanum tuberosum] Length = 165 Score = 102 bits (253), Expect = 7e-20 Identities = 46/56 (82%), Positives = 52/56 (92%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGRE+ ISLD VRDKN+MQLKK+NTA+FPVRYNDKYY DAIASG+FT+LAYY DIC Sbjct: 3 AGREVAISLDGVRDKNMMQLKKINTAIFPVRYNDKYYTDAIASGDFTRLAYYSDIC 58 >ref|NP_196695.1| GCN5-related N-acetyltransferase (GNAT) family protein [Arabidopsis thaliana] gi|8953396|emb|CAB96669.1| separation anxiety protein-like [Arabidopsis thaliana] gi|28416617|gb|AAO42839.1| At5g11340 [Arabidopsis thaliana] gi|110743265|dbj|BAE99523.1| separation anxiety protein - like [Arabidopsis thaliana] gi|332004280|gb|AED91663.1| GCN5-related N-acetyltransferase (GNAT) family protein [Arabidopsis thaliana] Length = 164 Score = 101 bits (252), Expect = 9e-20 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGRE+++SLD VRDKNLMQLK LNT LFPVRYNDKYYADAIA+GEFTKLAYY DIC Sbjct: 3 AGREVSVSLDGVRDKNLMQLKILNTVLFPVRYNDKYYADAIAAGEFTKLAYYNDIC 58 >ref|XP_004138740.1| PREDICTED: N-alpha-acetyltransferase 50-like isoform 1 [Cucumis sativus] gi|449499276|ref|XP_004160773.1| PREDICTED: N-alpha-acetyltransferase 50-like isoform 1 [Cucumis sativus] Length = 164 Score = 101 bits (251), Expect = 1e-19 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = +3 Query: 54 GRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 GR++ ISLD VRDKNLMQLKKLNTALFPVRYN+KYYAD +ASGEFTKLAYY DIC Sbjct: 4 GRQVPISLDGVRDKNLMQLKKLNTALFPVRYNEKYYADVLASGEFTKLAYYSDIC 58 >ref|XP_003618084.1| N-acetyltransferase NAT13 [Medicago truncatula] gi|355519419|gb|AET01043.1| N-acetyltransferase NAT13 [Medicago truncatula] Length = 164 Score = 101 bits (251), Expect = 1e-19 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGRE++ISLD VRDKN+MQLKKLN ALFPVRYNDKYYADA+AS +FTKLAYY DIC Sbjct: 3 AGREVSISLDGVRDKNIMQLKKLNLALFPVRYNDKYYADALASADFTKLAYYSDIC 58 >ref|NP_001235839.1| uncharacterized protein LOC100527165 [Glycine max] gi|255631696|gb|ACU16215.1| unknown [Glycine max] Length = 164 Score = 101 bits (251), Expect = 1e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGR ++ISLD VRDKNLMQLKKLN ALFPVRYNDKYY DA+ASGEFTKLAYY DIC Sbjct: 3 AGRGVSISLDGVRDKNLMQLKKLNLALFPVRYNDKYYVDALASGEFTKLAYYSDIC 58 >ref|XP_004241808.1| PREDICTED: N-alpha-acetyltransferase 50-like [Solanum lycopersicum] Length = 165 Score = 100 bits (249), Expect = 2e-19 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = +3 Query: 54 GRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 GRE+ ISLD VRDKN+MQLKK+NTA+FPVRYNDKYY DAIASG+FT+LAYY DIC Sbjct: 4 GREVAISLDGVRDKNMMQLKKINTAIFPVRYNDKYYTDAIASGDFTRLAYYSDIC 58 >gb|EPS73274.1| hypothetical protein M569_01484 [Genlisea aurea] Length = 160 Score = 100 bits (248), Expect = 3e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +3 Query: 66 TISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 +ISLD VRDKN MQLKKLNTALFPVRYNDKYYADA+ASGEF+KLAYYCDIC Sbjct: 3 SISLDGVRDKNAMQLKKLNTALFPVRYNDKYYADALASGEFSKLAYYCDIC 53 >ref|XP_004491672.1| PREDICTED: probable N-acetyltransferase san-like [Cicer arietinum] Length = 98 Score = 100 bits (248), Expect = 3e-19 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = +3 Query: 54 GRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 GRE++ISLD VRDKN+MQLKKLN ALFPVRYNDKYYADA+AS EFTKLAYY DIC Sbjct: 4 GREVSISLDDVRDKNIMQLKKLNIALFPVRYNDKYYADALASAEFTKLAYYSDIC 58 >ref|XP_004245217.1| PREDICTED: N-alpha-acetyltransferase 50-like [Solanum lycopersicum] Length = 162 Score = 100 bits (248), Expect = 3e-19 Identities = 45/56 (80%), Positives = 52/56 (92%) Frame = +3 Query: 51 AGRELTISLDAVRDKNLMQLKKLNTALFPVRYNDKYYADAIASGEFTKLAYYCDIC 218 AGRE+ ISLD VRDKN+MQLKK+NTALFP+RYNDKYY+DA+AS +FTKLAYY DIC Sbjct: 3 AGREMLISLDNVRDKNMMQLKKINTALFPIRYNDKYYSDALASADFTKLAYYSDIC 58