BLASTX nr result
ID: Mentha29_contig00021704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00021704 (489 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007027548.1| Uncharacterized protein TCM_022371 [Theobrom... 64 2e-08 ref|XP_004305377.1| PREDICTED: protein CHUP1, chloroplastic-like... 62 8e-08 ref|XP_004246905.1| PREDICTED: protein CHUP1, chloroplastic-like... 58 2e-06 ref|XP_002519412.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 ref|XP_002307197.2| hypothetical protein POPTR_0005s10120g [Popu... 55 8e-06 >ref|XP_007027548.1| Uncharacterized protein TCM_022371 [Theobroma cacao] gi|508716153|gb|EOY08050.1| Uncharacterized protein TCM_022371 [Theobroma cacao] Length = 443 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +3 Query: 201 MESSSSKVEVMKPVLLKAGIPLAASIAGFVLARIVARRSSVPTASS 338 MESSSSK EV+KPV+LKAGIPLA S+AGF+ ARI+A+R P SS Sbjct: 1 MESSSSKSEVIKPVILKAGIPLALSVAGFIYARIIAKRRIHPEVSS 46 >ref|XP_004305377.1| PREDICTED: protein CHUP1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 439 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = +3 Query: 201 MESSSSKVEVMKPVLLKAGIPLAASIAGFVLARIVARRSS 320 MESS+SKVE+ KPVLLKAGIPLA S+AGF+ ARI+A+RS+ Sbjct: 1 MESSTSKVEMFKPVLLKAGIPLALSVAGFIYARIMAQRST 40 >ref|XP_004246905.1| PREDICTED: protein CHUP1, chloroplastic-like [Solanum lycopersicum] Length = 517 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/40 (62%), Positives = 37/40 (92%) Frame = +3 Query: 201 MESSSSKVEVMKPVLLKAGIPLAASIAGFVLARIVARRSS 320 ME++SSKVE+MKPV LKAGIP+A ++AG+++A+I +R+SS Sbjct: 1 MENNSSKVEMMKPVFLKAGIPIALTLAGYIIAKITSRKSS 40 >ref|XP_002519412.1| conserved hypothetical protein [Ricinus communis] gi|223541275|gb|EEF42826.1| conserved hypothetical protein [Ricinus communis] Length = 412 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 201 MESSSSKVEVMKPVLLKAGIPLAASIAGFVLARIVARR 314 MESS SK EVMKP+ LKAGIPLA S+A F+ ARI++RR Sbjct: 1 MESSRSKTEVMKPLFLKAGIPLALSVASFIYARIISRR 38 >ref|XP_002307197.2| hypothetical protein POPTR_0005s10120g [Populus trichocarpa] gi|550338522|gb|EEE94193.2| hypothetical protein POPTR_0005s10120g [Populus trichocarpa] Length = 355 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 201 MESSSSKVEVMKPVLLKAGIPLAASIAGFVLARIVAR 311 MES+SS+ EVMKP+ LKAGIPL S+AGFV ARIV R Sbjct: 4 MESTSSRTEVMKPLFLKAGIPLVLSVAGFVYARIVLR 40