BLASTX nr result
ID: Mentha29_contig00021598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00021598 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29298.1| hypothetical protein MIMGU_mgv1a000685mg [Mimulus... 89 8e-16 ref|XP_002516533.1| serine-threonine protein kinase, plant-type,... 59 9e-07 >gb|EYU29298.1| hypothetical protein MIMGU_mgv1a000685mg [Mimulus guttatus] Length = 1018 Score = 88.6 bits (218), Expect = 8e-16 Identities = 45/61 (73%), Positives = 51/61 (83%) Frame = -1 Query: 331 RPSMKEVVQILQRTSPLDSEKQAGKEYDVVPLLGAEKYISSYRCDSKKLLDQSDNSLVSL 152 RP+MKEV +IL R LD +K AGKEYDV PLLG +KYISSYRCDSKKL+D+ DNSLVSL Sbjct: 959 RPTMKEVTKILLRCKSLDGKK-AGKEYDVAPLLGEDKYISSYRCDSKKLMDEIDNSLVSL 1017 Query: 151 V 149 V Sbjct: 1018 V 1018 >ref|XP_002516533.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223544353|gb|EEF45874.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 1026 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/58 (50%), Positives = 42/58 (72%) Frame = -1 Query: 331 RPSMKEVVQILQRTSPLDSEKQAGKEYDVVPLLGAEKYISSYRCDSKKLLDQSDNSLV 158 RPSMK+V+Q+L+R SP ++ G E+DV PLL + Y+SSY+ SK++ D+ D SLV Sbjct: 967 RPSMKDVLQVLRRYSPTSYKENMGSEFDVAPLLASATYLSSYK-HSKRVSDEYDCSLV 1023