BLASTX nr result
ID: Mentha29_contig00021086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00021086 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32456.1| hypothetical protein MIMGU_mgv1a012592mg [Mimulus... 65 7e-09 ref|XP_006356304.1| PREDICTED: bidirectional sugar transporter S... 56 6e-06 >gb|EYU32456.1| hypothetical protein MIMGU_mgv1a012592mg [Mimulus guttatus] Length = 245 Score = 65.5 bits (158), Expect = 7e-09 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 5/53 (9%) Frame = +1 Query: 1 IPNGFGCGLGSVQLILYAIYRNNKGE----GGNKSMEMEKPGS-KTLPQKQSD 144 IPNGFGCGLG+VQLILYAIYR NKGE G +S+EM+K G+ KT QKQ + Sbjct: 191 IPNGFGCGLGAVQLILYAIYRKNKGEIKKQTGEESVEMDKIGNGKTEQQKQDE 243 >ref|XP_006356304.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Solanum tuberosum] Length = 250 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/53 (54%), Positives = 33/53 (62%), Gaps = 6/53 (11%) Frame = +1 Query: 1 IPNGFGCGLGSVQLILYAIYRNNKG------EGGNKSMEMEKPGSKTLPQKQS 141 +PNG G LG+ QLILYAIYR NKG E G ME+EKP K +P QS Sbjct: 193 VPNGVGSFLGTAQLILYAIYRENKGQIKKGEEDGRVEMELEKPYEKEIPNTQS 245