BLASTX nr result
ID: Mentha29_contig00021009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00021009 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006399489.1| hypothetical protein EUTSA_v10013514mg [Eutr... 69 7e-10 ref|XP_002871399.1| hypothetical protein ARALYDRAFT_487826 [Arab... 67 2e-09 gb|ACK44524.1| AT5G10010-like protein [Arabidopsis arenosa] 67 2e-09 ref|XP_006287756.1| hypothetical protein CARUB_v10000966mg [Caps... 66 6e-09 ref|NP_196563.2| uncharacterized protein [Arabidopsis thaliana] ... 66 6e-09 gb|EXB80823.1| hypothetical protein L484_020078 [Morus notabilis] 63 5e-08 ref|XP_004504025.1| PREDICTED: uncharacterized protein LOC101491... 63 5e-08 ref|XP_006428047.1| hypothetical protein CICLE_v10025987mg [Citr... 62 6e-08 ref|XP_007048099.1| Myosin-H heavy chain isoform 1 [Theobroma ca... 62 6e-08 ref|XP_004149148.1| PREDICTED: uncharacterized protein LOC101209... 62 1e-07 ref|XP_006354712.1| PREDICTED: uncharacterized protein LOC102587... 61 1e-07 ref|XP_007159755.1| hypothetical protein PHAVU_002G264400g [Phas... 61 1e-07 ref|XP_003531377.1| PREDICTED: uncharacterized protein LOC100782... 61 1e-07 ref|XP_003523264.1| PREDICTED: uncharacterized protein LOC100801... 61 1e-07 ref|XP_004237438.1| PREDICTED: uncharacterized protein LOC101248... 61 2e-07 gb|AAZ66923.1| 117M18_4 [Brassica rapa] 60 2e-07 ref|XP_007137603.1| hypothetical protein PHAVU_009G140200g [Phas... 60 3e-07 ref|XP_002280295.1| PREDICTED: uncharacterized protein LOC100247... 60 3e-07 ref|XP_003525073.1| PREDICTED: uncharacterized protein LOC100805... 60 4e-07 gb|AHM26631.1| a-b binding protein [Pyrus x bretschneideri] 59 5e-07 >ref|XP_006399489.1| hypothetical protein EUTSA_v10013514mg [Eutrema salsugineum] gi|557100579|gb|ESQ40942.1| hypothetical protein EUTSA_v10013514mg [Eutrema salsugineum] Length = 453 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 KFYKFYP PSPDTPDVSGVK P+INRY+G AHKV+ Sbjct: 419 KFYKFYPQPSPDTPDVSGVKSPFINRYYGKAHKVL 453 >ref|XP_002871399.1| hypothetical protein ARALYDRAFT_487826 [Arabidopsis lyrata subsp. lyrata] gi|297317236|gb|EFH47658.1| hypothetical protein ARALYDRAFT_487826 [Arabidopsis lyrata subsp. lyrata] Length = 433 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 KFYKFYP PSPDTPDVSGVK P+INRY+G AH+V+ Sbjct: 399 KFYKFYPQPSPDTPDVSGVKSPFINRYYGKAHEVL 433 >gb|ACK44524.1| AT5G10010-like protein [Arabidopsis arenosa] Length = 433 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 KFYKFYP PSPDTPDVSGVK P+INRY+G AH+V+ Sbjct: 399 KFYKFYPQPSPDTPDVSGVKSPFINRYYGKAHEVL 433 >ref|XP_006287756.1| hypothetical protein CARUB_v10000966mg [Capsella rubella] gi|482556462|gb|EOA20654.1| hypothetical protein CARUB_v10000966mg [Capsella rubella] Length = 442 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 KFYKFYP PSPDTPDVSGV+ P+INRY+G AH+V+ Sbjct: 408 KFYKFYPQPSPDTPDVSGVQSPFINRYYGKAHEVL 442 >ref|NP_196563.2| uncharacterized protein [Arabidopsis thaliana] gi|124300950|gb|ABN04727.1| At5g10010 [Arabidopsis thaliana] gi|332004098|gb|AED91481.1| uncharacterized protein AT5G10010 [Arabidopsis thaliana] Length = 434 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 KFYKFYP PSPDTPDVSGV+ P+INRY+G AH+V+ Sbjct: 400 KFYKFYPQPSPDTPDVSGVQSPFINRYYGKAHEVL 434 >gb|EXB80823.1| hypothetical protein L484_020078 [Morus notabilis] Length = 317 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 KFYKFYPV +PDTPD+S VK P+INRY+G AH+++ Sbjct: 283 KFYKFYPVETPDTPDISNVKAPFINRYYGKAHEIL 317 >ref|XP_004504025.1| PREDICTED: uncharacterized protein LOC101491153 [Cicer arietinum] Length = 351 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 +FYKFYPVPSP+ PDVS VK P+INRY+G AH+V+ Sbjct: 317 RFYKFYPVPSPEAPDVSNVKSPFINRYYGKAHEVL 351 >ref|XP_006428047.1| hypothetical protein CICLE_v10025987mg [Citrus clementina] gi|568882037|ref|XP_006493848.1| PREDICTED: uncharacterized protein LOC102607131 [Citrus sinensis] gi|557530037|gb|ESR41287.1| hypothetical protein CICLE_v10025987mg [Citrus clementina] Length = 348 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 +FYKFYPV +PDTPDVS VK P+INRY+G AH+V+ Sbjct: 314 RFYKFYPVKTPDTPDVSNVKAPFINRYYGKAHEVL 348 >ref|XP_007048099.1| Myosin-H heavy chain isoform 1 [Theobroma cacao] gi|508700360|gb|EOX92256.1| Myosin-H heavy chain isoform 1 [Theobroma cacao] Length = 348 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 +FYKFYPV +PDTPDVS VK P+INRY+G AH+V+ Sbjct: 314 RFYKFYPVQTPDTPDVSNVKAPFINRYYGKAHEVL 348 >ref|XP_004149148.1| PREDICTED: uncharacterized protein LOC101209148 [Cucumis sativus] gi|449529880|ref|XP_004171926.1| PREDICTED: uncharacterized protein LOC101225957 [Cucumis sativus] Length = 338 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 KFYKFYPV +PD+PD+S VK P+INRY+G AH+V+ Sbjct: 304 KFYKFYPVQTPDSPDISNVKAPFINRYYGKAHEVL 338 >ref|XP_006354712.1| PREDICTED: uncharacterized protein LOC102587731 [Solanum tuberosum] Length = 351 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKV 166 KFYK+YPV SPD PDVS VK P+INRY+G AHKV Sbjct: 317 KFYKYYPVTSPDAPDVSQVKSPFINRYYGKAHKV 350 >ref|XP_007159755.1| hypothetical protein PHAVU_002G264400g [Phaseolus vulgaris] gi|561033170|gb|ESW31749.1| hypothetical protein PHAVU_002G264400g [Phaseolus vulgaris] Length = 340 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 +FYKFYPV SPD PDVS VK P+INRY+G AH+V+ Sbjct: 306 RFYKFYPVQSPDAPDVSNVKSPFINRYYGKAHEVL 340 >ref|XP_003531377.1| PREDICTED: uncharacterized protein LOC100782686 [Glycine max] Length = 340 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 +FYKFYPV SPD PDVS VK P+INRY+G AH+V+ Sbjct: 306 RFYKFYPVQSPDAPDVSNVKSPFINRYYGKAHEVL 340 >ref|XP_003523264.1| PREDICTED: uncharacterized protein LOC100801162 [Glycine max] Length = 329 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 +FYKFYPV SPD PDVS VK P+INRY+G AH+V+ Sbjct: 295 RFYKFYPVQSPDAPDVSNVKSPFINRYYGKAHEVL 329 >ref|XP_004237438.1| PREDICTED: uncharacterized protein LOC101248476 [Solanum lycopersicum] Length = 380 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKV 166 KFYK+YPV SPD PDVS VK P+INRY+G AHK+ Sbjct: 346 KFYKYYPVTSPDAPDVSQVKSPFINRYYGKAHKI 379 >gb|AAZ66923.1| 117M18_4 [Brassica rapa] Length = 424 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 KFYKFYP+PS +TPDVSGVK P+INRY+G A +V+ Sbjct: 390 KFYKFYPLPSSETPDVSGVKSPFINRYYGKADQVL 424 >ref|XP_007137603.1| hypothetical protein PHAVU_009G140200g [Phaseolus vulgaris] gi|561010690|gb|ESW09597.1| hypothetical protein PHAVU_009G140200g [Phaseolus vulgaris] Length = 328 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 +FYKFYP+ SPD PDVS VK P+INRY+G AH+V+ Sbjct: 294 RFYKFYPMQSPDAPDVSNVKSPFINRYYGKAHEVL 328 >ref|XP_002280295.1| PREDICTED: uncharacterized protein LOC100247396 [Vitis vinifera] gi|296082493|emb|CBI21498.3| unnamed protein product [Vitis vinifera] Length = 333 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 KFYKFYPV + DTPD+S VK P+INRY+G AH+V+ Sbjct: 299 KFYKFYPVQTEDTPDISNVKAPFINRYYGKAHEVL 333 >ref|XP_003525073.1| PREDICTED: uncharacterized protein LOC100805080 [Glycine max] Length = 340 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 +FYKFYPV SP+ PDVS VK P+INRY+G AH+V+ Sbjct: 306 RFYKFYPVQSPEAPDVSNVKSPFINRYYGKAHEVL 340 >gb|AHM26631.1| a-b binding protein [Pyrus x bretschneideri] Length = 1217 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 267 KFYKFYPVPSPDTPDVSGVKCPYINRYFGYAHKVI 163 ++YKFYPV +PDTPD+SGVK YINRY+ AH+V+ Sbjct: 1183 RYYKFYPVQTPDTPDISGVKAAYINRYYNKAHEVL 1217