BLASTX nr result
ID: Mentha29_contig00020847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00020847 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22687.1| hypothetical protein MIMGU_mgv1a025081mg [Mimulus... 57 3e-06 >gb|EYU22687.1| hypothetical protein MIMGU_mgv1a025081mg [Mimulus guttatus] Length = 457 Score = 56.6 bits (135), Expect = 3e-06 Identities = 36/86 (41%), Positives = 43/86 (50%), Gaps = 4/86 (4%) Frame = -2 Query: 392 DYDHHQLPLMPPQVKQFMPRDDCESSASPAAAANYQPCEPDLECDQSSQPPINEWDRLVG 213 +YD P QVKQFM DD + S +++ D + EWD LV Sbjct: 374 NYDQQSPPHHSMQVKQFMSTDDDDDSCHQPIISSHDQLHLTARSDDHQS--LTEWDPLVT 431 Query: 212 S---NPTSI-NHLSLRSEMDFWAYGK 147 S NP I N LSLRSEMDFW+YGK Sbjct: 432 SHHHNPNPIINPLSLRSEMDFWSYGK 457