BLASTX nr result
ID: Mentha29_contig00020725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00020725 (220 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42433.1| hypothetical protein MIMGU_mgv1a009847mg [Mimulus... 80 4e-13 gb|EYU20917.1| hypothetical protein MIMGU_mgv1a009848mg [Mimulus... 74 2e-11 ref|XP_006366190.1| PREDICTED: probable xyloglucan endotransgluc... 63 4e-08 gb|EPS60647.1| hypothetical protein M569_14156, partial [Genlise... 63 4e-08 dbj|BAO02549.1| endo-(1,4)-beta-D-glucanase ortholog, partial [N... 61 1e-07 ref|XP_004243015.1| PREDICTED: probable xyloglucan endotransgluc... 61 2e-07 ref|XP_002273742.2| PREDICTED: probable xyloglucan endotransgluc... 56 4e-06 gb|AGR44475.1| xyloglucan endotransglycosylase 2 [Pyrus x bretsc... 56 6e-06 emb|CBI17802.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_002274858.1| PREDICTED: probable xyloglucan endotransgluc... 56 6e-06 ref|XP_006453412.1| hypothetical protein CICLE_v10010798mg [Citr... 55 1e-05 ref|XP_007014183.1| Xyloglucan endotransglycosylase 6 [Theobroma... 55 1e-05 ref|XP_007223160.1| hypothetical protein PRUPE_ppa009417mg [Prun... 55 1e-05 ref|XP_003633213.1| PREDICTED: probable xyloglucan endotransgluc... 55 1e-05 emb|CBI17804.3| unnamed protein product [Vitis vinifera] 55 1e-05 ref|XP_002270182.1| PREDICTED: probable xyloglucan endotransgluc... 55 1e-05 ref|XP_002270416.1| PREDICTED: probable xyloglucan endotransgluc... 55 1e-05 ref|XP_002274601.1| PREDICTED: probable xyloglucan endotransgluc... 55 1e-05 emb|CAN80250.1| hypothetical protein VITISV_036640 [Vitis vinifera] 55 1e-05 emb|CAN80252.1| hypothetical protein VITISV_036642 [Vitis vinifera] 55 1e-05 >gb|EYU42433.1| hypothetical protein MIMGU_mgv1a009847mg [Mimulus guttatus] Length = 329 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = +1 Query: 1 FARKEVLMMELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECSIN 147 ++ K L MELDERSRE MKR+QRE MVYDYC D RRFP GPAPEC+IN Sbjct: 281 YSTKPFLKMELDERSRENMKRLQRERMVYDYCTDVRRFPQGPAPECTIN 329 >gb|EYU20917.1| hypothetical protein MIMGU_mgv1a009848mg [Mimulus guttatus] Length = 329 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = +1 Query: 1 FARKEVLMMELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECSIN 147 F K VL MELD RSR RMK++Q+++MVYDYC D RFP GP PEC IN Sbjct: 281 FTTKNVLKMELDRRSRARMKKVQKDHMVYDYCTDKWRFPKGPGPECKIN 329 >ref|XP_006366190.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 25-like [Solanum tuberosum] Length = 342 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +1 Query: 19 LMMELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECSI 144 L ELD RSR RMK +Q+++M+YDYC D RFP GPAPEC + Sbjct: 299 LTYELDRRSRVRMKALQKKHMIYDYCNDKWRFPKGPAPECKL 340 >gb|EPS60647.1| hypothetical protein M569_14156, partial [Genlisea aurea] Length = 100 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +1 Query: 16 VLMMELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPEC 138 V+ ELD +SR MK++Q+ +MVYDYCRD RFP GPAPEC Sbjct: 60 VMKAELDRKSRTAMKKLQKRHMVYDYCRDKWRFPKGPAPEC 100 >dbj|BAO02549.1| endo-(1,4)-beta-D-glucanase ortholog, partial [Nicotiana alata] Length = 324 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = +1 Query: 1 FARKEVLMMELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECSI 144 F L ELD RSR +MK +Q+++M+YDYC D RFP GPAPEC + Sbjct: 276 FGNNAWLSHELDRRSRAKMKILQKKHMIYDYCMDKWRFPKGPAPECRL 323 >ref|XP_004243015.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 25-like [Solanum lycopersicum] Length = 342 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +1 Query: 19 LMMELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECSI 144 L ELD SR RMK +Q+++M+YDYC D RFP GPAPEC + Sbjct: 299 LTYELDRTSRVRMKALQKKHMIYDYCNDKWRFPKGPAPECKL 340 >ref|XP_002273742.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 23-like [Vitis vinifera] Length = 297 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +1 Query: 28 ELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECS 141 ELD S+ERMK +Q+ YM+Y+YC D +RFP G PECS Sbjct: 255 ELDSTSQERMKWVQKNYMIYNYCADTKRFPQGLPPECS 292 >gb|AGR44475.1| xyloglucan endotransglycosylase 2 [Pyrus x bretschneideri] Length = 282 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +1 Query: 19 LMMELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECS 141 L LD +ERMK +Q+ YM+Y+YCRD +RFP G PECS Sbjct: 240 LTQSLDSTGQERMKWVQKNYMIYNYCRDTKRFPQGFPPECS 280 >emb|CBI17802.3| unnamed protein product [Vitis vinifera] Length = 200 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +1 Query: 28 ELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECS 141 ELD S+ERMK +Q+ YM+Y+YC D +RFP G +PEC+ Sbjct: 158 ELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLSPECT 195 >ref|XP_002274858.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 23 [Vitis vinifera] Length = 296 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +1 Query: 28 ELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECS 141 ELD S+ERMK +Q+ YM+Y+YC D +RFP G +PEC+ Sbjct: 254 ELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLSPECT 291 >ref|XP_006453412.1| hypothetical protein CICLE_v10010798mg [Citrus clementina] gi|557556638|gb|ESR66652.1| hypothetical protein CICLE_v10010798mg [Citrus clementina] Length = 288 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/36 (58%), Positives = 29/36 (80%) Frame = +1 Query: 28 ELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPE 135 ELDE SRE++K +Q+ YM+Y+YC D +RFP GP P+ Sbjct: 253 ELDETSREKLKWVQKNYMIYNYCTDTKRFPKGPPPD 288 >ref|XP_007014183.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao] gi|508784546|gb|EOY31802.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao] Length = 296 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/43 (51%), Positives = 31/43 (72%) Frame = +1 Query: 19 LMMELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECSIN 147 L ELD ++ER+K +Q+ YM+Y+YC D +RFP G PEC+ N Sbjct: 251 LSEELDSTAQERLKWVQKNYMIYNYCSDTKRFPQGLPPECAAN 293 >ref|XP_007223160.1| hypothetical protein PRUPE_ppa009417mg [Prunus persica] gi|462420096|gb|EMJ24359.1| hypothetical protein PRUPE_ppa009417mg [Prunus persica] Length = 293 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/47 (48%), Positives = 32/47 (68%) Frame = +1 Query: 7 RKEVLMMELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECSIN 147 R +L ELD +ER++ +Q+ YMVY+YC D +RFP G PEC+ N Sbjct: 245 RSVLLSEELDSTGQERLQWVQKNYMVYNYCTDTKRFPQGLPPECTAN 291 >ref|XP_003633213.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 23-like [Vitis vinifera] Length = 345 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 28 ELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECS 141 ELD S+ERMK +Q+ YM+Y+YC D +RFP G PEC+ Sbjct: 255 ELDSTSQERMKWVQKNYMIYNYCSDTKRFPQGLPPECT 292 >emb|CBI17804.3| unnamed protein product [Vitis vinifera] Length = 201 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 28 ELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECS 141 ELD S+ERMK +Q+ YM+Y+YC D +RFP G PEC+ Sbjct: 159 ELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPECT 196 >ref|XP_002270182.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 23-like [Vitis vinifera] Length = 296 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 28 ELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECS 141 ELD S+ERMK +Q+ YM+Y+YC D +RFP G PEC+ Sbjct: 254 ELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPECT 291 >ref|XP_002270416.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 23 [Vitis vinifera] Length = 296 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 28 ELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECS 141 ELD S+ERMK +Q+ YM+Y+YC D +RFP G PEC+ Sbjct: 254 ELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPECT 291 >ref|XP_002274601.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 23 [Vitis vinifera] Length = 297 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 28 ELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECS 141 ELD S+ERMK +Q+ YM+Y+YC D +RFP G PEC+ Sbjct: 255 ELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPECT 292 >emb|CAN80250.1| hypothetical protein VITISV_036640 [Vitis vinifera] Length = 287 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 28 ELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECS 141 ELD S+ERMK +Q+ YM+Y+YC D +RFP G PEC+ Sbjct: 245 ELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPECT 282 >emb|CAN80252.1| hypothetical protein VITISV_036642 [Vitis vinifera] Length = 287 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 28 ELDERSRERMKRMQREYMVYDYCRDDRRFPNGPAPECS 141 ELD S+ERMK +Q+ YM+Y+YC D +RFP G PEC+ Sbjct: 245 ELDSTSQERMKWVQKNYMIYNYCSDTKRFPQGLPPECT 282