BLASTX nr result
ID: Mentha29_contig00020331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00020331 (499 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26793.1| hypothetical protein MIMGU_mgv1a0006321mg, partia... 55 8e-06 >gb|EYU26793.1| hypothetical protein MIMGU_mgv1a0006321mg, partial [Mimulus guttatus] Length = 821 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -1 Query: 475 CIPEEGNYCSAIYSTLSSPVSALKFATSGFRFVAGFDYG 359 C+PEE N+CSAI+S +SPV AL+FATSG R V GF G Sbjct: 555 CLPEERNHCSAIFSISTSPVCALQFATSGVRLVVGFQSG 593