BLASTX nr result
ID: Mentha29_contig00020325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00020325 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46210.1| hypothetical protein MIMGU_mgv1a008386mg [Mimulus... 100 4e-19 ref|XP_006446248.1| hypothetical protein CICLE_v10015553mg [Citr... 59 5e-07 ref|XP_006470730.1| PREDICTED: F-box protein At4g18380-like [Cit... 58 2e-06 ref|XP_002531125.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 gb|EXC68150.1| F-box protein [Morus notabilis] 55 8e-06 >gb|EYU46210.1| hypothetical protein MIMGU_mgv1a008386mg [Mimulus guttatus] Length = 375 Score = 99.8 bits (247), Expect = 4e-19 Identities = 51/61 (83%), Positives = 54/61 (88%), Gaps = 1/61 (1%) Frame = +2 Query: 194 EDFFDRLPDDVVLSIFVKLQDARSLCLSMAACKRFRSIAPQVDRIFLPIP-QKKSGAKES 370 +D FDRLPD+VVLSIF KLQDARSLCLSMAACKRFRSIAPQV IFLP+P QKKS KES Sbjct: 18 DDSFDRLPDEVVLSIFEKLQDARSLCLSMAACKRFRSIAPQVGEIFLPVPHQKKSAIKES 77 Query: 371 D 373 D Sbjct: 78 D 78 >ref|XP_006446248.1| hypothetical protein CICLE_v10015553mg [Citrus clementina] gi|557548859|gb|ESR59488.1| hypothetical protein CICLE_v10015553mg [Citrus clementina] Length = 389 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/76 (39%), Positives = 46/76 (60%), Gaps = 4/76 (5%) Frame = +2 Query: 125 FDSHSSQTPKSTMDSSSEQILHSE----DFFDRLPDDVVLSIFVKLQDARSLCLSMAACK 292 F+ ++ P ++ E+I+ E D+FD LPD ++L IF KL DA+SL + CK Sbjct: 30 FEYSQAKQPIKRKNNQMERIVLQEEKADDYFDSLPDAILLDIFNKLLDAKSLTRCLVVCK 89 Query: 293 RFRSIAPQVDRIFLPI 340 RF S+ PQ++ +FL I Sbjct: 90 RFSSLIPQINNLFLSI 105 >ref|XP_006470730.1| PREDICTED: F-box protein At4g18380-like [Citrus sinensis] Length = 345 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/60 (45%), Positives = 39/60 (65%) Frame = +2 Query: 161 MDSSSEQILHSEDFFDRLPDDVVLSIFVKLQDARSLCLSMAACKRFRSIAPQVDRIFLPI 340 M+ +Q +D+FD LPD ++L IF KL DA+SL + CKRF S+ PQ++ +FL I Sbjct: 1 MERIVQQEEKPDDYFDSLPDAILLDIFNKLLDAKSLTRCLVVCKRFSSLIPQINNLFLSI 60 >ref|XP_002531125.1| conserved hypothetical protein [Ricinus communis] gi|223529289|gb|EEF31259.1| conserved hypothetical protein [Ricinus communis] Length = 356 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/60 (48%), Positives = 37/60 (61%) Frame = +2 Query: 191 SEDFFDRLPDDVVLSIFVKLQDARSLCLSMAACKRFRSIAPQVDRIFLPIPQKKSGAKES 370 +EDFFD LPD ++L IF KL D+RSL + KRF S+ Q D +FL IP K + S Sbjct: 11 NEDFFDPLPDSLLLLIFNKLCDSRSLAQCLLVSKRFSSLVFQADNVFLSIPTPKPKSASS 70 >gb|EXC68150.1| F-box protein [Morus notabilis] Length = 352 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/56 (42%), Positives = 37/56 (66%) Frame = +2 Query: 188 HSEDFFDRLPDDVVLSIFVKLQDARSLCLSMAACKRFRSIAPQVDRIFLPIPQKKS 355 H D+FD+LPD ++ IF K+ DA++L + KRF S+ Q D +FLP+P +K+ Sbjct: 19 HRRDYFDQLPDPLLHLIFNKILDAKTLVRCLPVSKRFNSLISQTDAVFLPLPPQKN 74