BLASTX nr result
ID: Mentha29_contig00020244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00020244 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006414306.1| hypothetical protein EUTSA_v10024621mg [Eutr... 72 6e-11 ref|XP_006410738.1| hypothetical protein EUTSA_v10016360mg [Eutr... 72 6e-11 gb|EYU19298.1| hypothetical protein MIMGU_mgv1a002541mg [Mimulus... 70 3e-10 ref|XP_002868103.1| Acyl-coenzyme A oxidase [Arabidopsis lyrata ... 70 4e-10 ref|NP_567513.4| peroxisomal acyl-coenzyme A oxidase 1 [Arabidop... 69 5e-10 ref|XP_006283277.1| hypothetical protein CARUB_v10004312mg [Caps... 69 5e-10 ref|NP_001234658.1| peroxisomal acyl-CoA oxidase 1B [Solanum lyc... 69 5e-10 pdb|1W07|A Chain A, Arabidopsis Thaliana Acyl-Coa Oxidase 1 gi|5... 69 5e-10 emb|CAB10450.1| acyl-CoA oxidase like protein [Arabidopsis thali... 69 5e-10 pdb|2FON|A Chain A, X-Ray Crystal Structure Of Leacx1, An Acyl-C... 69 7e-10 ref|XP_006355420.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 69 9e-10 gb|AAW78691.1| peroxisomal acyl-CoA oxidase 1A [Solanum cheesman... 69 9e-10 ref|NP_001234198.1| peroxisomal acyl-CoA oxidase 1A [Solanum lyc... 69 9e-10 ref|XP_006477146.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 68 2e-09 ref|XP_006355418.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 68 2e-09 ref|XP_006440266.1| hypothetical protein CICLE_v10019196mg [Citr... 68 2e-09 ref|XP_006440265.1| hypothetical protein CICLE_v10019196mg [Citr... 68 2e-09 ref|XP_006440264.1| hypothetical protein CICLE_v10019196mg [Citr... 68 2e-09 ref|XP_006293812.1| hypothetical protein CARUB_v10022793mg [Caps... 67 3e-09 ref|XP_006293811.1| hypothetical protein CARUB_v10022793mg [Caps... 67 3e-09 >ref|XP_006414306.1| hypothetical protein EUTSA_v10024621mg [Eutrema salsugineum] gi|557115476|gb|ESQ55759.1| hypothetical protein EUTSA_v10024621mg [Eutrema salsugineum] Length = 664 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M GVD LADER KAEFDVD MKIVWAGSR AFEVSDRIS+LV Sbjct: 1 MEGVDHLADERNKAEFDVDEMKIVWAGSRHAFEVSDRISRLV 42 >ref|XP_006410738.1| hypothetical protein EUTSA_v10016360mg [Eutrema salsugineum] gi|557111907|gb|ESQ52191.1| hypothetical protein EUTSA_v10016360mg [Eutrema salsugineum] Length = 664 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M GVD LADERKKAEFDVD MKIVWAGSR AFEVS+RIS+LV Sbjct: 1 MEGVDHLADERKKAEFDVDDMKIVWAGSRHAFEVSNRISRLV 42 >gb|EYU19298.1| hypothetical protein MIMGU_mgv1a002541mg [Mimulus guttatus] Length = 661 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +2 Query: 176 VDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 +D LADERKKA FDVDSMKIVWAGSR AFEVSDRISKLV Sbjct: 1 MDYLADERKKAVFDVDSMKIVWAGSRQAFEVSDRISKLV 39 >ref|XP_002868103.1| Acyl-coenzyme A oxidase [Arabidopsis lyrata subsp. lyrata] gi|297313939|gb|EFH44362.1| Acyl-coenzyme A oxidase [Arabidopsis lyrata subsp. lyrata] Length = 664 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M GVD LADER KAEFDV+ MKIVWAGSR AFEVSDRI++LV Sbjct: 1 MEGVDHLADERNKAEFDVEEMKIVWAGSRHAFEVSDRIARLV 42 >ref|NP_567513.4| peroxisomal acyl-coenzyme A oxidase 1 [Arabidopsis thaliana] gi|62286589|sp|O65202.1|ACOX1_ARATH RecName: Full=Peroxisomal acyl-coenzyme A oxidase 1; Short=AOX 1; AltName: Full=Long-chain acyl-CoA oxidase; Short=AtCX1 gi|3044214|gb|AAC13498.1| acyl-CoA oxidase [Arabidopsis thaliana] gi|16604462|gb|AAL24237.1| AT4g16760/dl4405c [Arabidopsis thaliana] gi|24111395|gb|AAN46824.1| At4g16760/dl4405c [Arabidopsis thaliana] gi|332658398|gb|AEE83798.1| peroxisomal acyl-coenzyme A oxidase 1 [Arabidopsis thaliana] Length = 664 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M G+D LADER KAEFDV+ MKIVWAGSR AFEVSDRI++LV Sbjct: 1 MEGIDHLADERNKAEFDVEDMKIVWAGSRHAFEVSDRIARLV 42 >ref|XP_006283277.1| hypothetical protein CARUB_v10004312mg [Capsella rubella] gi|482551982|gb|EOA16175.1| hypothetical protein CARUB_v10004312mg [Capsella rubella] Length = 664 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M GVD LADER KAEFDVD MKIVWAGS AFEVSDRI++LV Sbjct: 1 MEGVDHLADERNKAEFDVDEMKIVWAGSHHAFEVSDRIARLV 42 >ref|NP_001234658.1| peroxisomal acyl-CoA oxidase 1B [Solanum lycopersicum] gi|58531950|gb|AAW78690.1| peroxisomal acyl-CoA oxidase 1B [Solanum lycopersicum] Length = 649 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M G+D LA+ERKKAEF+VD MKIVWAGSR AFEVSD ISKLV Sbjct: 1 MEGIDYLAEERKKAEFNVDEMKIVWAGSRRAFEVSDYISKLV 42 >pdb|1W07|A Chain A, Arabidopsis Thaliana Acyl-Coa Oxidase 1 gi|58177067|pdb|1W07|B Chain B, Arabidopsis Thaliana Acyl-Coa Oxidase 1 Length = 659 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M G+D LADER KAEFDV+ MKIVWAGSR AFEVSDRI++LV Sbjct: 1 MEGIDHLADERNKAEFDVEDMKIVWAGSRHAFEVSDRIARLV 42 >emb|CAB10450.1| acyl-CoA oxidase like protein [Arabidopsis thaliana] gi|7268426|emb|CAB78718.1| acyl-CoA oxidase like protein [Arabidopsis thaliana] Length = 895 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M G+D LADER KAEFDV+ MKIVWAGSR AFEVSDRI++LV Sbjct: 214 MEGIDHLADERNKAEFDVEDMKIVWAGSRHAFEVSDRIARLV 255 >pdb|2FON|A Chain A, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) gi|109157677|pdb|2FON|B Chain B, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) gi|109157678|pdb|2FON|C Chain C, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) Length = 683 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +2 Query: 164 KMAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 +M GVD LADERKKA FDVD MKIVWAGSR FE++DRISKLV Sbjct: 19 EMEGVDYLADERKKAGFDVDEMKIVWAGSRHDFELTDRISKLV 61 >ref|XP_006355420.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Solanum tuberosum] Length = 664 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M GVD LADERKKA FDVD MKIVWAGSR FE++DRISKLV Sbjct: 1 MEGVDYLADERKKAGFDVDEMKIVWAGSRHDFELTDRISKLV 42 >gb|AAW78691.1| peroxisomal acyl-CoA oxidase 1A [Solanum cheesmaniae] Length = 664 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M GVD LADERKKA FDVD MKIVWAGSR FE++DRISKLV Sbjct: 1 MEGVDYLADERKKAGFDVDEMKIVWAGSRHDFELTDRISKLV 42 >ref|NP_001234198.1| peroxisomal acyl-CoA oxidase 1A [Solanum lycopersicum] gi|58531948|gb|AAW78689.1| peroxisomal acyl-CoA oxidase 1A [Solanum lycopersicum] Length = 664 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M GVD LADERKKA FDVD MKIVWAGSR FE++DRISKLV Sbjct: 1 MEGVDYLADERKKAGFDVDEMKIVWAGSRHDFELTDRISKLV 42 >ref|XP_006477146.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Citrus sinensis] Length = 664 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M GVD LA ERKKA+FDVD MKIVWAGSR AF+VSDRI++LV Sbjct: 1 MDGVDQLAPERKKAQFDVDEMKIVWAGSRHAFQVSDRIARLV 42 >ref|XP_006355418.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like isoform X1 [Solanum tuberosum] Length = 664 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M +D LADERKKAEF+VD MKIVWAGSR AFEVSD ISKLV Sbjct: 1 MERIDYLADERKKAEFNVDEMKIVWAGSRRAFEVSDYISKLV 42 >ref|XP_006440266.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|567895558|ref|XP_006440267.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542528|gb|ESR53506.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542529|gb|ESR53507.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 529 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M GVD LA ERKKA+FDVD MKIVWAGSR AF+VSDRI++LV Sbjct: 1 MDGVDQLAPERKKAQFDVDEMKIVWAGSRHAFQVSDRIARLV 42 >ref|XP_006440265.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542527|gb|ESR53505.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 601 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M GVD LA ERKKA+FDVD MKIVWAGSR AF+VSDRI++LV Sbjct: 1 MDGVDQLAPERKKAQFDVDEMKIVWAGSRHAFQVSDRIARLV 42 >ref|XP_006440264.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542526|gb|ESR53504.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 664 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +2 Query: 167 MAGVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 M GVD LA ERKKA+FDVD MKIVWAGSR AF+VSDRI++LV Sbjct: 1 MDGVDQLAPERKKAQFDVDEMKIVWAGSRHAFQVSDRIARLV 42 >ref|XP_006293812.1| hypothetical protein CARUB_v10022793mg [Capsella rubella] gi|482562520|gb|EOA26710.1| hypothetical protein CARUB_v10022793mg [Capsella rubella] Length = 665 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = +2 Query: 173 GVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 G+D LADER KAEFDVD+MK+VWAGSR AF+VS+R+S+LV Sbjct: 4 GIDHLADERSKAEFDVDAMKLVWAGSRHAFDVSNRVSRLV 43 >ref|XP_006293811.1| hypothetical protein CARUB_v10022793mg [Capsella rubella] gi|482562519|gb|EOA26709.1| hypothetical protein CARUB_v10022793mg [Capsella rubella] Length = 562 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = +2 Query: 173 GVDCLADERKKAEFDVDSMKIVWAGSRSAFEVSDRISKLV 292 G+D LADER KAEFDVD+MK+VWAGSR AF+VS+R+S+LV Sbjct: 4 GIDHLADERSKAEFDVDAMKLVWAGSRHAFDVSNRVSRLV 43