BLASTX nr result
ID: Mentha29_contig00020212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00020212 (1062 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003602216.1| hypothetical protein MTR_3g091130 [Medicago ... 58 6e-06 >ref|XP_003602216.1| hypothetical protein MTR_3g091130 [Medicago truncatula] gi|355491264|gb|AES72467.1| hypothetical protein MTR_3g091130 [Medicago truncatula] Length = 300 Score = 58.2 bits (139), Expect = 6e-06 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -1 Query: 747 DIIARFGKQEAMPRFFFFTNLVKVTQD*GQHFTLLAKIISGAFNYY 610 DIIARFGKQEAMPR FF T+ VKV QD G+HFTLLA + +YY Sbjct: 104 DIIARFGKQEAMPREFF-TDFVKVAQDEGRHFTLLAARLEELGSYY 148